Homologs in group_3701

Help

2 homologs were identified in 2 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_12535 FBDBKF_12535 94.4 Morganella morganii S1 rcnR Ni(II)/Co(II)-binding transcriptional repressor RcnR
PMI_RS02225 PMI_RS02225 42.5 Proteus mirabilis HI4320 frmR formaldehyde-responsive transcriptional repressor FrmR

Distribution of the homologs in the orthogroup group_3701

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3701

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
A8AP75 2.41e-53 164 87 0 90 3 rcnR Transcriptional repressor RcnR Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q3Z0A5 4.55e-53 163 88 0 90 3 rcnR Transcriptional repressor RcnR Shigella sonnei (strain Ss046)
P64533 4.55e-53 163 88 0 90 3 rcnR Transcriptional repressor RcnR homolog Shigella flexneri
Q0T334 4.55e-53 163 88 0 90 3 rcnR Transcriptional repressor RcnR Shigella flexneri serotype 5b (strain 8401)
Q32E99 4.55e-53 163 88 0 90 3 rcnR Transcriptional repressor RcnR Shigella dysenteriae serotype 1 (strain Sd197)
Q1R9W7 4.55e-53 163 88 0 90 3 rcnR Transcriptional repressor RcnR Escherichia coli (strain UTI89 / UPEC)
P64530 4.55e-53 163 88 0 90 1 rcnR Transcriptional repressor RcnR Escherichia coli (strain K12)
P64531 4.55e-53 163 88 0 90 3 rcnR Transcriptional repressor RcnR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TFY7 4.55e-53 163 88 0 90 3 rcnR Transcriptional repressor RcnR Escherichia coli O6:K15:H31 (strain 536 / UPEC)
P0C7I3 4.55e-53 163 88 0 90 3 rcnR Transcriptional repressor RcnR Escherichia coli O1:K1 / APEC
A8A1X0 4.55e-53 163 88 0 90 3 rcnR Transcriptional repressor RcnR Escherichia coli O9:H4 (strain HS)
P64532 4.55e-53 163 88 0 90 3 rcnR Transcriptional repressor RcnR Escherichia coli O157:H7
A7ZNS4 4.55e-53 163 88 0 90 3 rcnR Transcriptional repressor RcnR homolog Escherichia coli O139:H28 (strain E24377A / ETEC)
Q7CPV3 1.57e-52 161 85 0 90 3 rcnR Transcriptional repressor RcnR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8XFV2 1.57e-52 161 85 0 90 3 rcnR Transcriptional repressor RcnR homolog Salmonella typhi
A9N3J4 1.57e-52 161 85 0 90 3 rcnR Transcriptional repressor RcnR Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PEQ5 1.57e-52 161 85 0 90 3 rcnR Transcriptional repressor RcnR Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q57K94 3.04e-52 160 85 0 90 3 rcnR Transcriptional repressor RcnR homolog Salmonella choleraesuis (strain SC-B67)
A9MRK3 3.96e-52 160 85 0 90 3 rcnR Transcriptional repressor RcnR Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
P55757 2.4e-24 90 48 1 91 3 None Uncharacterized protein in bioA 5'region Serratia marcescens
Q3Z549 4.95e-15 67 47 0 63 3 frmR Transcriptional repressor FrmR Shigella sonnei (strain Ss046)
Q1RFI6 4.95e-15 67 47 0 63 3 frmR Transcriptional repressor FrmR Escherichia coli (strain UTI89 / UPEC)
B1LIP2 4.95e-15 67 47 0 63 3 frmR Transcriptional repressor FrmR Escherichia coli (strain SMS-3-5 / SECEC)
P0AAP3 4.95e-15 67 47 0 63 1 frmR Transcriptional repressor FrmR Escherichia coli (strain K12)
B1J084 4.95e-15 67 47 0 63 3 frmR Transcriptional repressor FrmR Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0AAP4 4.95e-15 67 47 0 63 3 frmR Transcriptional repressor FrmR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TKS6 4.95e-15 67 47 0 63 3 frmR Transcriptional repressor FrmR Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1A836 4.95e-15 67 47 0 63 3 frmR Transcriptional repressor FrmR Escherichia coli O1:K1 / APEC
A7ZX05 4.95e-15 67 47 0 63 3 frmR Transcriptional repressor FrmR Escherichia coli O9:H4 (strain HS)
Q8X5J3 4.95e-15 67 47 0 63 3 frmR Transcriptional repressor FrmR Escherichia coli O157:H7
A7ZIA5 4.95e-15 67 47 0 63 3 frmR Transcriptional repressor FrmR Escherichia coli O139:H28 (strain E24377A / ETEC)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS07765
Feature type CDS
Gene rcnR
Product Ni(II)/Co(II)-binding transcriptional repressor RcnR
Location 1621627 - 1621899 (strand: 1)
Length 273 (nucleotides) / 90 (amino acids)

Contig

Accession term accessions NZ_VXKB01000001 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3701
Orthogroup size 3
N. genomes 3

Actions

Genomic region

Domains

PF02583 Metal-sensitive transcriptional repressor

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1937 Transcription (K) K DNA-binding transcriptional regulator, FrmR family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K23240 FrmR/RcnR family transcriptional regulator, repressor of rcnA expression - -

Protein Sequence

MSHTIRDKQKLQNRASKIQGQVNSLKKMLDEPHECAAVLQQIAAIRGAVNGLMREVIKGHLTEHVVHQEDEEKRQDDLDIVLKVLDSYIK

Flanking regions ( +/- flanking 50bp)

GCTACTATTTTACCCGTTAACTCTATATTTCCTTATCTCACAGGGCTGCTATGTCACACACCATCAGGGATAAACAGAAGCTTCAGAACCGGGCCAGTAAAATTCAGGGGCAGGTAAATTCACTGAAAAAAATGCTGGATGAACCTCATGAGTGCGCGGCTGTTCTGCAACAAATTGCGGCGATACGCGGCGCGGTTAACGGGTTAATGCGGGAAGTGATTAAAGGACACCTGACAGAACATGTTGTTCATCAGGAAGATGAGGAAAAGCGTCAGGATGATTTGGATATCGTGCTGAAAGTGCTGGACTCTTATATTAAATAATTTATTGCATTGTATTTTATCCGGTTCTCCCGGTTGTTATTTTTACACTG