Homologs in group_3696

Help

2 homologs were identified in 2 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
F4V73_RS07765 F4V73_RS07765 94.4 Morganella psychrotolerans rcnR Ni(II)/Co(II)-binding transcriptional repressor RcnR
PMI_RS02225 PMI_RS02225 40.2 Proteus mirabilis HI4320 frmR formaldehyde-responsive transcriptional repressor FrmR

Distribution of the homologs in the orthogroup group_3696

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3696

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q3Z0A5 4.79e-50 155 84 0 90 3 rcnR Transcriptional repressor RcnR Shigella sonnei (strain Ss046)
P64533 4.79e-50 155 84 0 90 3 rcnR Transcriptional repressor RcnR homolog Shigella flexneri
Q0T334 4.79e-50 155 84 0 90 3 rcnR Transcriptional repressor RcnR Shigella flexneri serotype 5b (strain 8401)
Q32E99 4.79e-50 155 84 0 90 3 rcnR Transcriptional repressor RcnR Shigella dysenteriae serotype 1 (strain Sd197)
Q1R9W7 4.79e-50 155 84 0 90 3 rcnR Transcriptional repressor RcnR Escherichia coli (strain UTI89 / UPEC)
P64530 4.79e-50 155 84 0 90 1 rcnR Transcriptional repressor RcnR Escherichia coli (strain K12)
P64531 4.79e-50 155 84 0 90 3 rcnR Transcriptional repressor RcnR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TFY7 4.79e-50 155 84 0 90 3 rcnR Transcriptional repressor RcnR Escherichia coli O6:K15:H31 (strain 536 / UPEC)
P0C7I3 4.79e-50 155 84 0 90 3 rcnR Transcriptional repressor RcnR Escherichia coli O1:K1 / APEC
A8A1X0 4.79e-50 155 84 0 90 3 rcnR Transcriptional repressor RcnR Escherichia coli O9:H4 (strain HS)
P64532 4.79e-50 155 84 0 90 3 rcnR Transcriptional repressor RcnR Escherichia coli O157:H7
A7ZNS4 4.79e-50 155 84 0 90 3 rcnR Transcriptional repressor RcnR homolog Escherichia coli O139:H28 (strain E24377A / ETEC)
A8AP75 1.17e-49 154 82 0 90 3 rcnR Transcriptional repressor RcnR Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q7CPV3 1.73e-49 154 81 0 90 3 rcnR Transcriptional repressor RcnR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8XFV2 1.73e-49 154 81 0 90 3 rcnR Transcriptional repressor RcnR homolog Salmonella typhi
A9N3J4 1.73e-49 154 81 0 90 3 rcnR Transcriptional repressor RcnR Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PEQ5 1.73e-49 154 81 0 90 3 rcnR Transcriptional repressor RcnR Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q57K94 3.35e-49 153 81 0 90 3 rcnR Transcriptional repressor RcnR homolog Salmonella choleraesuis (strain SC-B67)
A9MRK3 4.55e-49 153 81 0 90 3 rcnR Transcriptional repressor RcnR Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
P55757 4.84e-24 89 49 1 91 3 None Uncharacterized protein in bioA 5'region Serratia marcescens
Q3Z549 3.22e-14 65 46 0 63 3 frmR Transcriptional repressor FrmR Shigella sonnei (strain Ss046)
Q1RFI6 3.22e-14 65 46 0 63 3 frmR Transcriptional repressor FrmR Escherichia coli (strain UTI89 / UPEC)
B1LIP2 3.22e-14 65 46 0 63 3 frmR Transcriptional repressor FrmR Escherichia coli (strain SMS-3-5 / SECEC)
P0AAP3 3.22e-14 65 46 0 63 1 frmR Transcriptional repressor FrmR Escherichia coli (strain K12)
B1J084 3.22e-14 65 46 0 63 3 frmR Transcriptional repressor FrmR Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0AAP4 3.22e-14 65 46 0 63 3 frmR Transcriptional repressor FrmR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TKS6 3.22e-14 65 46 0 63 3 frmR Transcriptional repressor FrmR Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1A836 3.22e-14 65 46 0 63 3 frmR Transcriptional repressor FrmR Escherichia coli O1:K1 / APEC
A7ZX05 3.22e-14 65 46 0 63 3 frmR Transcriptional repressor FrmR Escherichia coli O9:H4 (strain HS)
Q8X5J3 3.22e-14 65 46 0 63 3 frmR Transcriptional repressor FrmR Escherichia coli O157:H7
A7ZIA5 3.22e-14 65 46 0 63 3 frmR Transcriptional repressor FrmR Escherichia coli O139:H28 (strain E24377A / ETEC)

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_12535
Feature type CDS
Gene rcnR
Product Ni(II)/Co(II)-binding transcriptional repressor RcnR
Location 22520 - 22792 (strand: 1)
Length 273 (nucleotides) / 90 (amino acids)
In genomic island -

Contig

Accession contig_15
Length 114235 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3696
Orthogroup size 3
N. genomes 3

Actions

Genomic region

Domains

PF02583 Metal-sensitive transcriptional repressor

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1937 Transcription (K) K DNA-binding transcriptional regulator, FrmR family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K23240 FrmR/RcnR family transcriptional regulator, repressor of rcnA expression - -

Protein Sequence

MSHTIRDRQKLQNRASKIQGQVNSLKKMLDEPHECSAVLQQIAAIRGAVNGLMREVIKGHLIEHVVHEEDEEKRQGDLDIVLKVLDSYIK

Flanking regions ( +/- flanking 50bp)

TGCTACTATTTTGCCCGTCACTTTCTTTTACCTTATTTCACGGGGTTGCCATGTCACATACCATCAGGGACAGACAGAAACTTCAGAACCGCGCCAGTAAAATTCAGGGGCAGGTCAACTCACTGAAAAAAATGCTCGATGAACCGCATGAGTGCTCCGCCGTGCTGCAGCAGATTGCAGCTATCCGGGGCGCGGTAAACGGATTAATGCGGGAAGTGATTAAGGGCCACCTGATTGAACACGTAGTTCATGAGGAAGATGAGGAAAAACGTCAGGGTGATCTGGATATTGTTCTGAAGGTGCTGGATTCTTATATTAAGTAAAGAAAAATTCAGCCGGTGTTGTAAAAATCCCCGGCGCCGGTCCTGTAAGT