Homologs in group_49

Help

12 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_02335 FBDBKF_02335 30.9 Morganella morganii S1 - Type 1 fimbrial protein
FBDBKF_14860 FBDBKF_14860 71.6 Morganella morganii S1 - Type 1 fimbrial protein
EHELCC_02805 EHELCC_02805 30.9 Morganella morganii S2 - Type 1 fimbrial protein
EHELCC_15665 EHELCC_15665 71.6 Morganella morganii S2 - Type 1 fimbrial protein
NLDBIP_00655 NLDBIP_00655 30.9 Morganella morganii S4 - Type 1 fimbrial protein
NLDBIP_16195 NLDBIP_16195 71.6 Morganella morganii S4 - Type 1 fimbrial protein
LHKJJB_01380 LHKJJB_01380 30.9 Morganella morganii S3 - Type 1 fimbrial protein
LHKJJB_15645 LHKJJB_15645 71.6 Morganella morganii S3 - Type 1 fimbrial protein
HKOGLL_01420 HKOGLL_01420 30.9 Morganella morganii S5 - Type 1 fimbrial protein
HKOGLL_14765 HKOGLL_14765 71.6 Morganella morganii S5 - Type 1 fimbrial protein
F4V73_RS04715 F4V73_RS04715 27.1 Morganella psychrotolerans - type 1 fimbrial protein
PMI_RS04090 PMI_RS04090 35.1 Proteus mirabilis HI4320 - hypothetical protein

Distribution of the homologs in the orthogroup group_49

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_49

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P75917 1.81e-05 43 29 1 78 2 ymdA Uncharacterized protein YmdA Escherichia coli (strain K12)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS07660
Feature type CDS
Gene -
Product hypothetical protein
Location 1602574 - 1602903 (strand: -1)
Length 330 (nucleotides) / 109 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000001
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_49
Orthogroup size 13
N. genomes 7

Actions

Genomic region

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3539 Cell motility (N) N Pilin (type 1 fimbrial protein)

Protein Sequence

MKKLLFFISVFGLLLSSITSASETKNRGSSGIIIFHGAIVEGPCMMDFQTNDISSRCYRSGMKKEQLNTKTITKKTTSLANLIPANVGHAKLQWIDDSKSLAMVVVSYL

Flanking regions ( +/- flanking 50bp)

TGCGGCGGCAAACGGACTGCTCCGCAACAGACTACCTAACGAGGTATACCATGAAAAAGCTACTATTCTTTATCTCTGTTTTCGGTTTGTTACTCAGTAGTATTACATCAGCATCAGAGACTAAAAATCGTGGATCGTCAGGCATTATCATATTCCACGGAGCTATTGTTGAGGGTCCCTGCATGATGGACTTTCAGACAAATGATATCAGCTCCCGTTGTTACCGCTCAGGGATGAAGAAGGAACAACTCAATACAAAAACGATTACCAAAAAAACCACATCACTCGCAAATCTGATCCCCGCAAATGTAGGGCATGCAAAACTGCAATGGATAGATGACAGCAAATCATTGGCAATGGTGGTTGTCAGTTATCTTTAATACAGAACAAAGCTCACTGTCAACTGTAAGCAGAGGAAACCGGTGATCGT