Homologs in group_9

Help

20 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_05295 FBDBKF_05295 89.4 Morganella morganii S1 oppA oligopeptide ABC transporter substrate-binding protein OppA
FBDBKF_05300 FBDBKF_05300 57.5 Morganella morganii S1 oppA ABC-type oligopeptide transport system, periplasmic component
FBDBKF_05570 FBDBKF_05570 44.3 Morganella morganii S1 oppA ABC-type oligopeptide transport system, periplasmic component
EHELCC_12020 EHELCC_12020 44.3 Morganella morganii S2 oppA ABC-type oligopeptide transport system, periplasmic component
EHELCC_12290 EHELCC_12290 57.5 Morganella morganii S2 oppA ABC-type oligopeptide transport system, periplasmic component
EHELCC_12295 EHELCC_12295 89.4 Morganella morganii S2 oppA oligopeptide ABC transporter substrate-binding protein OppA
NLDBIP_12360 NLDBIP_12360 44.3 Morganella morganii S4 oppA ABC-type oligopeptide transport system, periplasmic component
NLDBIP_12630 NLDBIP_12630 57.5 Morganella morganii S4 oppA ABC-type oligopeptide transport system, periplasmic component
NLDBIP_12635 NLDBIP_12635 89.4 Morganella morganii S4 oppA oligopeptide ABC transporter substrate-binding protein OppA
LHKJJB_12220 LHKJJB_12220 44.3 Morganella morganii S3 oppA ABC-type oligopeptide transport system, periplasmic component
LHKJJB_12490 LHKJJB_12490 57.5 Morganella morganii S3 oppA ABC-type oligopeptide transport system, periplasmic component
LHKJJB_12495 LHKJJB_12495 89.4 Morganella morganii S3 oppA oligopeptide ABC transporter substrate-binding protein OppA
HKOGLL_10835 HKOGLL_10835 44.3 Morganella morganii S5 oppA ABC-type oligopeptide transport system, periplasmic component
HKOGLL_11105 HKOGLL_11105 57.5 Morganella morganii S5 oppA ABC-type oligopeptide transport system, periplasmic component
HKOGLL_11110 HKOGLL_11110 89.4 Morganella morganii S5 oppA oligopeptide ABC transporter substrate-binding protein OppA
F4V73_RS03735 F4V73_RS03735 45.0 Morganella psychrotolerans - peptide ABC transporter substrate-binding protein
F4V73_RS05755 F4V73_RS05755 56.2 Morganella psychrotolerans - ABC transporter substrate-binding protein
PMI_RS06600 PMI_RS06600 43.6 Proteus mirabilis HI4320 - peptide ABC transporter substrate-binding protein
PMI_RS07140 PMI_RS07140 77.6 Proteus mirabilis HI4320 oppA oligopeptide ABC transporter substrate-binding protein OppA
PMI_RS07145 PMI_RS07145 55.9 Proteus mirabilis HI4320 - ABC transporter substrate-binding protein

Distribution of the homologs in the orthogroup group_9

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_9

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P06202 0.0 807 71 2 545 1 oppA Periplasmic oligopeptide-binding protein OppA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P23843 0.0 795 68 2 545 1 oppA Periplasmic oligopeptide-binding protein OppA Escherichia coli (strain K12)
P71370 0.0 591 54 4 536 3 oppA Periplasmic oligopeptide-binding protein OppA Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P77348 2.6e-170 496 45 3 531 1 mppA Periplasmic murein peptide-binding protein MppA Escherichia coli (strain K12)
Q46863 7.01e-150 443 42 6 542 1 ygiS Probable deoxycholate-binding periplasmic protein YgiS Escherichia coli (strain K12)
P24141 4.51e-92 295 36 13 519 1 oppA Oligopeptide-binding protein OppA Bacillus subtilis (strain 168)
P26906 1.29e-75 252 33 16 531 1 dppE Dipeptide-binding protein DppE Bacillus subtilis (strain 168)
P44572 1.23e-66 227 27 10 490 3 HI_0213 Putative binding protein HI_0213 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A2RI74 5.04e-44 167 29 21 527 1 dppA Dipeptide-binding protein Lactococcus lactis subsp. cremoris (strain MG1363)
P76128 2.2e-35 142 26 15 507 2 ddpA Probable D,D-dipeptide-binding periplasmic protein DdpA Escherichia coli (strain K12)
A0A0H2ZGV7 8.99e-32 132 24 15 514 1 dppA4 Di/tripeptide-binding protein 4 Pseudomonas aeruginosa (strain UCBPP-PA14)
P33950 2.34e-31 131 26 13 463 1 hbpA Heme-binding protein A Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P75797 2.45e-30 127 25 14 523 1 gsiB Glutathione-binding protein GsiB Escherichia coli (strain K12)
Q8X6V9 9.24e-30 126 25 14 523 3 gsiB Glutathione-binding protein GsiB Escherichia coli O157:H7
Q32IB6 1.04e-29 125 24 15 538 3 gsiB Glutathione-binding protein GsiB Shigella dysenteriae serotype 1 (strain Sd197)
Q3Z3V3 1.22e-29 125 25 14 523 3 gsiB Glutathione-binding protein GsiB Shigella sonnei (strain Ss046)
Q323W4 3.4e-29 124 25 14 523 3 gsiB Glutathione-binding protein GsiB Shigella boydii serotype 4 (strain Sb227)
Q1RE95 3.74e-29 124 25 14 523 3 gsiB Glutathione-binding protein GsiB Escherichia coli (strain UTI89 / UPEC)
Q8CW88 3.74e-29 124 25 14 523 3 gsiB Glutathione-binding protein GsiB Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A1A968 3.74e-29 124 25 14 523 3 gsiB Glutathione-binding protein GsiB Escherichia coli O1:K1 / APEC
Q821B3 4.91e-29 124 25 14 523 3 gsiB Glutathione-binding protein GsiB Shigella flexneri
Q0TJL8 1.94e-28 122 24 14 523 3 gsiB Glutathione-binding protein GsiB Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q0T6D2 2.25e-27 119 24 15 525 3 gsiB Glutathione-binding protein GsiB Shigella flexneri serotype 5b (strain 8401)
P33590 7.1e-27 117 27 19 470 1 nikA Nickel-binding periplasmic protein Escherichia coli (strain K12)
Q8ZQM3 7.22e-27 117 23 14 533 3 gsiB Glutathione-binding protein GsiB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8Z863 9.55e-27 117 23 14 533 3 gsiB Glutathione-binding protein GsiB Salmonella typhi
Q57RB1 1.62e-26 116 23 14 533 3 gsiB Glutathione-binding protein GsiB Salmonella choleraesuis (strain SC-B67)
Q5PGP4 2.97e-26 115 23 14 533 3 gsiB Glutathione-binding protein GsiB Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q9HVS4 1.1e-25 114 22 13 471 1 PA4497 Tripeptide-binding protein Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P23847 1.62e-25 113 23 20 561 1 dppA Dipeptide-binding protein Escherichia coli (strain K12)
A0A0H2ZGW2 3.6e-25 112 22 13 471 1 dppA2 Di/tripeptide-binding protein 2 Pseudomonas aeruginosa (strain UCBPP-PA14)
Q9HVS1 5.41e-23 106 22 13 474 1 PA4500 Dipeptide-binding protein Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
A0A0H2ZGN2 1.58e-22 104 22 13 460 1 dppA3 Di/tripeptide-binding protein 3 Pseudomonas aeruginosa (strain UCBPP-PA14)
Q6D3B0 1.89e-22 104 23 15 550 3 gsiB Glutathione-binding protein GsiB Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A0A0H2ZI72 2.29e-22 103 21 15 503 1 dppA5 Probable di/tripeptide-binding protein 5 Pseudomonas aeruginosa (strain UCBPP-PA14)
A0A0H2ZGV2 2.9e-22 103 22 16 523 1 dppA1 Di/tripeptide-binding protein 1 Pseudomonas aeruginosa (strain UCBPP-PA14)
P0A4G1 1.29e-20 99 30 10 260 1 aliB Oligopeptide-binding protein AliB Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P0A4G0 1.29e-20 99 30 10 260 3 aliB Oligopeptide-binding protein AliB Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
P06109 4.09e-20 97 25 20 441 3 xp55 Protein XP55 Streptomyces lividans
P31306 1.31e-19 96 24 8 319 1 sarA Oligopeptide-binding protein SarA Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)
P35592 7.24e-18 90 25 9 320 3 aliA Oligopeptide-binding protein AliA Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q8FUX2 4.29e-16 84 22 19 510 3 BRA1090 Putative peptide-binding periplasmic protein BRA1090/BS1330_II1082 Brucella suis biovar 1 (strain 1330)
Q2YJK2 1.31e-15 83 22 19 510 3 BAB2_1049 Putative peptide-binding periplasmic protein BAB2_1049 Brucella abortus (strain 2308)
Q8VQK3 1.31e-15 83 22 19 510 3 BruAb2_1030 Putative peptide-binding periplasmic protein BruAb2_1030 Brucella abortus biovar 1 (strain 9-941)
Q8YDG6 1.35e-15 83 22 19 510 3 BMEII0210 Putative peptide-binding periplasmic protein BMEII0210 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
P36634 2.46e-15 82 22 19 538 2 sapA Peptide transport periplasmic protein SapA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q47622 7.71e-15 80 23 16 454 3 sapA Probable ABC transporter periplasmic-binding protein SapA Escherichia coli (strain K12)
P18791 1.1e-13 77 26 5 213 1 amiA Oligopeptide-binding protein AmiA Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
P42061 1.33e-10 67 23 18 433 1 appA Oligopeptide-binding protein AppA Bacillus subtilis (strain 168)
Q9CEK0 1.51e-10 67 23 26 507 3 oppA Oligopeptide-binding protein OppA Lactococcus lactis subsp. lactis (strain IL1403)
P55669 1.55e-10 67 23 18 438 3 NGR_a01440 Probable peptide ABC transporter periplasmic-binding protein y4tO Sinorhizobium fredii (strain NBRC 101917 / NGR234)
P55691 2.42e-10 67 20 19 501 3 NGR_a00920 Uncharacterized protein y4wM Sinorhizobium fredii (strain NBRC 101917 / NGR234)
P45285 3.21e-10 66 23 11 320 3 sapA Peptide transport periplasmic protein SapA Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q02VA9 6.09e-10 65 22 22 488 3 oppA Oligopeptide-binding protein OppA Lactococcus lactis subsp. cremoris (strain SK11)
Q8YBP0 1.81e-09 63 25 14 340 3 BMEII0859 Putative ABC transporter peptide-binding protein BMEII0859 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q8FWN7 2.08e-09 63 25 14 340 3 BRA0409 Putative ABC transporter peptide-binding protein BRA0409/BS1330_II0406 Brucella suis biovar 1 (strain 1330)
Q2YK66 2.08e-09 63 25 14 340 3 BAB2_0812 Putative ABC transporter peptide-binding protein BAB2_0812 Brucella abortus (strain 2308)
Q577J8 2.08e-09 63 25 14 340 3 BruAb2_0792 Putative ABC transporter peptide-binding protein BruAb2_0792 Brucella abortus biovar 1 (strain 9-941)
A5VU91 2.08e-09 63 25 14 340 3 BOV_A0352 Putative ABC transporter peptide-binding protein BOV_A0352 Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q07741 2.65e-09 63 24 21 437 1 oppA Oligopeptide-binding protein OppA Lactococcus lactis subsp. lactis
Q9RU24 8.64e-08 58 21 17 391 1 DR_1571 Probable ABC transporter-binding protein DR_1571 Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
A9CIN5 6.14e-07 55 23 22 481 3 yepA Peptidoglycan-binding protein YepA Agrobacterium fabrum (strain C58 / ATCC 33970)
P66772 7.27e-07 55 21 16 411 3 BQ2027_MB1311C Uncharacterized protein Mb1311c Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WGU5 7.27e-07 55 21 16 411 1 Rv1280c Uncharacterized protein Rv1280c Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGU4 7.27e-07 55 21 16 411 3 MT1317 Uncharacterized protein MT1317 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q9X4Y1 2.44e-06 54 24 14 350 2 agpA Periplasmic alpha-galactoside-binding protein Rhizobium meliloti (strain 1021)
A0A0H3JTL0 2.78e-05 50 20 17 548 1 cntA Metal-staphylopine-binding protein CntA Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q8FW84 4.33e-05 50 22 9 239 3 BRA0576 Putative binding protein BRA0576/BS1330_II0571 Brucella suis biovar 1 (strain 1330)
Q2YKJ5 4.52e-05 50 22 9 239 3 BAB2_0664 Putative binding protein BAB2_0664 Brucella abortus (strain 2308)
Q577X5 4.52e-05 50 22 9 239 3 BruAb2_0648 Putative binding protein BruAb2_0648 Brucella abortus biovar 1 (strain 9-941)
Q8YC41 4.59e-05 50 22 9 239 3 BMEII0691 Putative binding protein BMEII0691 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q2G2P5 9.11e-05 48 27 9 218 1 nikA Nickel-binding protein NikA Staphylococcus aureus (strain NCTC 8325 / PS 47)
P9WL77 0.000146 48 21 18 489 1 Rv2585c Uncharacterized lipoprotein Rv2585c Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P59984 0.000254 47 21 20 491 3 BQ2027_MB2616C Uncharacterized lipoprotein Mb2616c Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WL76 0.000254 47 21 20 491 3 MT2662 Uncharacterized lipoprotein MT2662 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
O07570 0.000355 47 20 12 304 3 yhjP Uncharacterized protein YhjP Bacillus subtilis (strain 168)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS05750
Feature type CDS
Gene oppA
Product oligopeptide ABC transporter substrate-binding protein OppA
Location 1220423 - 1222063 (strand: -1)
Length 1641 (nucleotides) / 546 (amino acids)

Contig

Accession term accessions NZ_VXKB01000001 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_9
Orthogroup size 21
N. genomes 7

Actions

Genomic region

Domains

PF00496 Bacterial extracellular solute-binding proteins, family 5 Middle

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG4166 Amino acid transport and metabolism (E) E ABC-type oligopeptide transport system, periplasmic component

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K15580 oligopeptide transport system substrate-binding protein beta-Lactam resistance
ABC transporters
Quorum sensing		 -

Protein Sequence

MVKLTKKSLLTLSVISALGMGLGAQAFAAEVPAGVQLAEKQDLVRNNGSEPQSLDPHKVEGVPEANIIRDLMEGITLEGPDGTVLPGSATSWENKDFKVWTFKIREGAKWSNGDPVTAQDFVYSWRRLADPNTASPYASYLQYAHIANIDDVIAGKKKPEELGIKALDDKTLEITLTEEVPYIPKLLAHNSMSPVHPASVEKFGDKWTQPGNYVSNGAYKLKNWVVNEKIELERNPNYWDNQKTVINNIRFLPISSEVTDVNRYRSGEIDMTYNNLPIELFQKLKKEIPDELRISPYMCTYYYEINNEKAPFNNPKVREALKLGLDRDIMVNKVKAQGDTPAYGFTPPFTDGMSAKEPEWFSGMTQAQRNEKARKLLEEAGYTKDKPLKFNLLYNTSDLHKKMAIAAASIWKKNIGVDVQLENQEWKTFLDTRHQGTYDIARAGWCADYNEPSSFLNMMLSYSSSNTPHYKNTDFDKLMKQSLQVKTDEERAKIYQQAETVLDNDSAIVPVYYYVSTRLVKPYVGGYSGKDPLDHLHTKDLYLMKK

Flanking regions ( +/- flanking 50bp)

AAAACACGCAACAAACGCAAAACACATTCGTCAATGGGGAGTTATGTAAGATGGTAAAGCTGACAAAGAAGAGTTTATTAACACTAAGTGTGATTAGTGCGCTGGGAATGGGATTGGGTGCTCAGGCGTTTGCGGCGGAGGTTCCGGCAGGGGTTCAGCTGGCTGAGAAGCAGGATCTGGTCCGTAATAACGGGTCTGAGCCGCAGTCGCTTGATCCGCATAAAGTGGAAGGGGTTCCGGAAGCCAATATTATCCGTGACCTGATGGAAGGGATCACACTTGAAGGCCCTGACGGTACTGTTTTACCGGGATCTGCGACATCCTGGGAAAATAAAGATTTTAAAGTCTGGACGTTTAAAATCCGTGAAGGCGCAAAATGGTCAAACGGTGATCCTGTCACCGCACAGGACTTTGTTTACAGCTGGCGTCGTTTAGCTGATCCGAATACCGCGTCACCGTATGCGAGTTATTTACAGTATGCCCATATTGCGAATATCGATGATGTTATTGCCGGGAAAAAGAAACCGGAAGAGCTCGGTATTAAAGCGCTGGATGATAAAACATTAGAAATTACCCTGACAGAAGAAGTGCCGTATATTCCGAAACTGCTGGCGCATAACTCTATGTCACCGGTGCATCCGGCTTCTGTCGAAAAGTTTGGTGATAAATGGACGCAGCCGGGAAATTATGTCAGTAACGGCGCGTACAAACTGAAAAACTGGGTAGTAAATGAAAAAATCGAGCTGGAGCGTAACCCGAATTATTGGGATAACCAAAAAACCGTTATTAATAATATCCGCTTCCTGCCTATTTCCTCAGAAGTCACTGATGTAAACCGCTACCGCAGCGGTGAAATCGACATGACGTATAATAACCTGCCGATTGAACTGTTCCAGAAACTGAAAAAAGAGATCCCGGACGAACTGCGTATTTCGCCGTATATGTGTACCTATTACTATGAAATCAATAATGAAAAAGCGCCGTTTAATAATCCGAAAGTCCGTGAGGCTCTGAAACTCGGTTTAGACCGCGATATCATGGTTAATAAAGTGAAAGCGCAGGGTGATACCCCGGCTTATGGCTTCACTCCACCGTTTACCGATGGTATGTCTGCGAAAGAGCCGGAGTGGTTCTCCGGAATGACTCAGGCACAGCGTAATGAAAAAGCACGGAAACTGCTGGAAGAAGCGGGCTACACCAAAGATAAACCGCTGAAATTCAATCTGCTGTATAACACGTCTGATCTGCACAAAAAAATGGCGATTGCCGCCGCATCTATCTGGAAGAAAAACATCGGTGTTGATGTGCAGCTGGAAAACCAGGAATGGAAAACATTCCTCGATACCCGCCATCAGGGCACGTATGATATTGCCCGCGCCGGCTGGTGTGCAGATTACAACGAGCCTTCATCTTTCCTGAATATGATGCTCTCCTACAGCAGCAGTAATACCCCGCATTATAAAAATACAGATTTTGATAAGCTGATGAAACAGTCTCTTCAGGTGAAAACTGATGAAGAGCGGGCAAAAATCTACCAGCAGGCTGAAACAGTGCTGGATAACGATTCCGCCATTGTGCCTGTCTATTACTATGTCAGTACCCGTTTAGTGAAACCGTACGTGGGGGGATACAGCGGAAAAGATCCGTTAGATCACCTTCATACAAAAGATCTTTATCTGATGAAAAAATAATAAAGACGGTTGGCAGCCTCCCCGGAGGCTGCCTGTGTATACCCGACGTC