Homologs in group_21

Help

18 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_08075 FBDBKF_08075 70.7 Morganella morganii S1 dmsB DMSO/selenate family reductase complex B subunit
FBDBKF_10455 FBDBKF_10455 50.3 Morganella morganii S1 dmsB DMSO/selenate family reductase complex B subunit
EHELCC_13905 EHELCC_13905 70.7 Morganella morganii S2 dmsB DMSO/selenate family reductase complex B subunit
EHELCC_14790 EHELCC_14790 50.3 Morganella morganii S2 dmsB DMSO/selenate family reductase complex B subunit
NLDBIP_14350 NLDBIP_14350 70.7 Morganella morganii S4 dmsB DMSO/selenate family reductase complex B subunit
NLDBIP_14620 NLDBIP_14620 50.3 Morganella morganii S4 dmsB DMSO/selenate family reductase complex B subunit
LHKJJB_08500 LHKJJB_08500 70.7 Morganella morganii S3 dmsB DMSO/selenate family reductase complex B subunit
LHKJJB_14725 LHKJJB_14725 50.3 Morganella morganii S3 dmsB DMSO/selenate family reductase complex B subunit
HKOGLL_08050 HKOGLL_08050 70.7 Morganella morganii S5 dmsB DMSO/selenate family reductase complex B subunit
HKOGLL_13345 HKOGLL_13345 50.3 Morganella morganii S5 dmsB DMSO/selenate family reductase complex B subunit
F4V73_RS12920 F4V73_RS12920 69.9 Morganella psychrotolerans - DMSO/selenate family reductase complex B subunit
F4V73_RS14155 F4V73_RS14155 49.7 Morganella psychrotolerans - DMSO/selenate family reductase complex B subunit
PMI_RS00325 PMI_RS00325 32.6 Proteus mirabilis HI4320 - 4Fe-4S dicluster domain-containing protein
PMI_RS00340 PMI_RS00340 30.2 Proteus mirabilis HI4320 - ferredoxin-like protein
PMI_RS00820 PMI_RS00820 44.1 Proteus mirabilis HI4320 - 4Fe-4S dicluster domain-containing protein
PMI_RS05815 PMI_RS05815 87.1 Proteus mirabilis HI4320 dmsB dimethylsulfoxide reductase subunit B
PMI_RS08350 PMI_RS08350 50.3 Proteus mirabilis HI4320 dmsB dimethylsulfoxide reductase subunit B
PMI_RS14660 PMI_RS14660 72.6 Proteus mirabilis HI4320 dmsB dimethylsulfoxide reductase subunit B

Distribution of the homologs in the orthogroup group_21

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_21

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P18776 3.29e-71 218 53 2 194 1 dmsB Anaerobic dimethyl sulfoxide reductase chain B Escherichia coli (strain K12)
Q83RZ7 3.48e-71 218 53 2 194 3 dmsB Anaerobic dimethyl sulfoxide reductase chain B Shigella flexneri
P0AAJ1 7.98e-71 217 53 2 194 3 ynfG Probable anaerobic dimethyl sulfoxide reductase chain YnfG Escherichia coli (strain K12)
P0AAJ2 7.98e-71 217 53 2 194 3 ynfG Probable anaerobic dimethyl sulfoxide reductase chain YnfG Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P45003 7.99e-69 212 50 1 195 3 dmsB Anaerobic dimethyl sulfoxide reductase chain B Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
D3RNN7 1.15e-31 118 36 5 193 1 soeB Sulfite dehydrogenase subunit B Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D)
P0A1I1 4.66e-30 112 39 5 158 1 phsB Thiosulfate reductase electron transfer subunit PhsB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A1I2 4.66e-30 112 39 5 158 3 phsB Thiosulfate reductase electron transfer subunit PhsB Salmonella typhi
P0AAJ4 1.08e-29 114 37 3 166 3 fdnH Formate dehydrogenase, nitrate-inducible, iron-sulfur subunit Shigella flexneri
P0AAJ3 1.08e-29 114 37 3 166 1 fdnH Formate dehydrogenase, nitrate-inducible, iron-sulfur subunit Escherichia coli (strain K12)
P44450 2.17e-28 111 36 2 166 3 fdxH Formate dehydrogenase iron-sulfur subunit Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P0AAJ7 1.31e-27 108 35 4 173 3 fdoH Formate dehydrogenase-O iron-sulfur subunit Shigella flexneri
P0AAJ5 1.31e-27 108 35 4 173 1 fdoH Formate dehydrogenase-O iron-sulfur subunit Escherichia coli (strain K12)
P0AAJ6 1.31e-27 108 35 4 173 3 fdoH Formate dehydrogenase-O iron-sulfur subunit Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q9HR73 2.22e-25 102 35 5 176 2 dmsB Putative dimethyl sulfoxide reductase iron-sulfur subunit B Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
P27273 3.83e-25 100 35 5 177 1 fdhB1 Formate dehydrogenase iron-sulfur subunit Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
Q7CQM9 4.26e-25 101 34 5 189 1 ttrB Tetrathionate reductase subunit B Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P31076 1.46e-24 98 35 7 191 4 psrB Polysulfide reductase chain B Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
P0AAK0 4.71e-24 100 35 5 176 3 hybA Hydrogenase-2 operon protein HybA Shigella flexneri
P0AAJ8 4.71e-24 100 35 5 176 3 hybA Hydrogenase-2 operon protein HybA Escherichia coli (strain K12)
P0AAJ9 4.71e-24 100 35 5 176 3 hybA Hydrogenase-2 operon protein HybA Escherichia coli O157:H7
O30080 1.9e-23 95 36 5 157 3 ttrB Tetrathionate reductase subunit B Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
P60069 1.04e-21 94 29 6 226 1 clrB Chlorate reductase subunit beta Ideonella dechloratans
P77375 1.53e-21 91 36 4 150 2 ydhX Uncharacterized ferredoxin-like protein YdhX Escherichia coli (strain K12)
Q8X616 3.7e-21 90 36 4 150 3 ydhX Uncharacterized ferredoxin-like protein YdhX Escherichia coli O157:H7
Q9S1G9 5.38e-21 92 28 6 228 1 serB Selenate reductase subunit beta Thauera selenatis
P33389 1.42e-20 91 33 4 175 4 DVU_0535 Protein DVU_0535 Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
P45015 1.52e-20 89 30 5 209 3 nrfC Protein NrfC homolog Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P0AAK9 2.69e-20 88 30 3 190 3 nrfC Protein NrfC Shigella flexneri
P0AAK7 2.69e-20 88 30 3 190 3 nrfC Protein NrfC Escherichia coli (strain K12)
P0AAK8 2.69e-20 88 30 3 190 3 nrfC Protein NrfC Escherichia coli O157:H7
Q47CW7 1.11e-19 88 28 7 253 1 pcrB Perchlorate reductase subunit beta Dechloromonas aromatica (strain RCB)
Q727P4 1.31e-18 83 29 3 174 1 DVU_2811 Formate dehydrogenase 2 subunit beta (cytochrome c-553) Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
Q7WTT9 2.38e-18 83 28 5 216 1 arrB Arsenate respiratory reductase iron-sulfur subunit ArrB Shewanella sp. (strain ANA-3)
P42176 1.59e-17 83 34 2 138 3 narH Nitrate reductase beta chain Bacillus subtilis (strain 168)
I3R9M8 5.22e-17 81 28 11 265 1 narH Respiratory nitrate reductase subunit beta Haloferax mediterranei (strain ATCC 33500 / DSM 1411 / JCM 8866 / NBRC 14739 / NCIMB 2177 / R-4)
Q8GPG3 2.25e-16 79 26 7 258 1 ddhB Dimethylsulfide dehydrogenase subunit beta Rhodovulum sulfidophilum
O29751 2.84e-16 78 31 8 196 1 hmeA Hdr-like menaquinol oxidoreductase iron-sulfur subunit 1 Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
P19318 8.43e-16 78 39 2 108 1 narY Respiratory nitrate reductase 2 beta chain Escherichia coli (strain K12)
Q83RN5 1.04e-15 78 39 1 103 3 narH Respiratory nitrate reductase 1 beta chain Shigella flexneri
P11349 1.08e-15 78 39 1 103 1 narH Respiratory nitrate reductase 1 beta chain Escherichia coli (strain K12)
Q8L3A9 1.35e-15 77 31 4 147 1 padI NADH-dependent phenylglyoxylate dehydrogenase subunit beta Aromatoleum evansii
Q8GC87 1.93e-15 75 27 6 188 1 fdhB Formate dehydrogenase subunit beta Megalodesulfovibrio gigas (strain ATCC 19364 / DSM 1382 / NCIMB 9332 / VKM B-1759)
Q72E85 3.19e-15 75 28 7 226 1 qrcC Menaquinone reductase, iron-sulfur cluster-binding subunit Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
Q46819 4.17e-15 72 28 5 159 4 ygfS Putative electron transport protein YgfS Escherichia coli (strain K12)
P0AAL8 8.65e-15 73 29 2 150 4 ydhY Uncharacterized ferredoxin-like protein YdhY Shigella flexneri
P0AAL6 8.65e-15 73 29 2 150 2 ydhY Uncharacterized ferredoxin-like protein YdhY Escherichia coli (strain K12)
P0AAL7 8.65e-15 73 29 2 150 4 ydhY Uncharacterized ferredoxin-like protein YdhY Escherichia coli O157:H7
Q46820 1.57e-13 72 30 5 157 2 uacF Putative oxidoreductase UacF Escherichia coli (strain K12)
P31894 3.69e-13 68 27 7 201 1 cooF Iron-sulfur protein Rhodospirillum rubrum
P56256 7.32e-12 64 25 6 160 4 ysaA Putative electron transport protein YsaA Escherichia coli (strain K12)
P37127 1.41e-11 66 28 5 155 2 aegA Putative oxidoreductase AegA Escherichia coli (strain K12)
Q57713 3.28e-11 62 30 8 172 3 MJ0265 Uncharacterized ferredoxin MJ0265 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
P85098 1.83e-10 62 29 3 144 1 narH Respiratory nitrate reductase beta chain (Fragments) Bradyrhizobium sp.
P0AAK4 6.04e-09 56 26 6 168 3 hydN Electron transport protein HydN Escherichia coli (strain K12)
P0AAK5 6.04e-09 56 26 6 168 3 hydN Electron transport protein HydN Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AAK6 6.04e-09 56 26 6 168 3 hydN Electron transport protein HydN Escherichia coli O157:H7
P23481 7.17e-09 57 26 8 191 2 hyfA Hydrogenase-4 component A Escherichia coli (strain K12)
P20925 1.53e-08 55 35 6 109 4 None Frd operon probable iron-sulfur subunit A (Fragment) Proteus vulgaris
P80564 5.08e-08 55 27 8 199 1 bthL Pyrogallol hydroxytransferase small subunit Pelobacter acidigallici
Q57619 7.77e-08 53 34 3 89 3 MJ0155 Uncharacterized ferredoxin MJ0155 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q57712 2.44e-06 48 36 3 87 3 MJ0264 Uncharacterized protein MJ0264 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
P0AAK3 2.8e-05 46 23 8 211 3 hycB Formate hydrogenlyase subunit 2 Shigella flexneri
P0AAK1 2.8e-05 46 23 8 211 1 hycB Formate hydrogenlyase subunit 2 Escherichia coli (strain K12)
P0AAK2 2.8e-05 46 23 8 211 3 hycB Formate hydrogenlyase subunit 2 Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
O27719 7.24e-05 46 36 2 68 4 MTH_1684 Uncharacterized protein MTH_1684 Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
Q57934 0.000128 45 34 3 85 4 MJ0514 Uncharacterized polyferredoxin-like protein MJ0514 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
P00195 0.000265 41 38 2 57 1 None Ferredoxin Clostridium pasteurianum
Q58699 0.000556 43 36 4 90 4 MJ1303 Uncharacterized polyferredoxin-like protein MJ1303 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q51800 0.000563 41 46 1 47 1 vorD Ketoisovalerate oxidoreductase subunit VorD Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
Q58566 0.000837 43 30 3 122 4 fwdF Polyferredoxin protein FwdF Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS05065
Feature type CDS
Gene -
Product DMSO/selenate family reductase complex B subunit
Location 1078300 - 1078929 (strand: -1)
Length 630 (nucleotides) / 209 (amino acids)

Contig

Accession term accessions NZ_VXKB01000001 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_21
Orthogroup size 19
N. genomes 7

Actions

Genomic region

Domains

PF13247 4Fe-4S dicluster domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0437 Energy production and conversion (C) C Fe-S-cluster-containing dehydrogenase component (DMSO reductase)

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K07307 anaerobic dimethyl sulfoxide reductase subunit B Sulfur metabolism
Metabolic pathways
-

Protein Sequence

MSDFKEYAPVSDEQLGFFIDSSRCSGCKACQVACKDKNNLEVGRKFRRVYEVQGGGFAPNGQGGYENNVFSYTLTISCNHCADPVCVKNCPTTAMHKRPGDGIVRVDTGKCVGCGYCAWSCPYGAPQMNKETGQMSKCDLCVDLLAEGQNPVCVDTCPLNAIKFGKIRELREKYGHLSQVQGLPDFTITQPNLVIKPHKGAQNKGEVKS

Flanking regions ( +/- flanking 50bp)

CTGGCACACGGTAACTCGCATCTGACAGTTTTGGTTGAGGTAATAAAAGCATGAGTGACTTTAAAGAATATGCACCGGTCAGTGATGAACAGCTCGGGTTCTTTATTGACTCCTCACGCTGTTCCGGCTGCAAAGCCTGCCAGGTAGCCTGTAAAGATAAAAACAATCTGGAAGTCGGGCGGAAATTCCGCCGCGTGTATGAAGTTCAGGGCGGGGGATTTGCACCCAATGGTCAGGGCGGCTATGAAAACAATGTGTTTTCCTACACCTTAACTATCTCCTGTAACCATTGTGCCGATCCGGTCTGTGTTAAAAACTGCCCGACCACCGCGATGCATAAACGTCCCGGCGATGGCATTGTGCGGGTTGATACCGGCAAATGTGTCGGCTGCGGCTATTGTGCCTGGTCGTGCCCTTACGGCGCGCCGCAGATGAATAAAGAGACGGGGCAAATGTCCAAATGTGACCTTTGTGTGGACTTGCTGGCAGAGGGTCAGAACCCTGTGTGTGTTGATACCTGTCCGCTGAATGCCATAAAATTCGGTAAAATCCGTGAACTTCGTGAAAAATACGGGCATTTAAGCCAGGTTCAGGGATTGCCGGACTTTACCATCACACAGCCGAATCTGGTGATAAAACCACACAAAGGCGCGCAGAATAAAGGGGAGGTTAAATCATGAGCGAGTGGCCGTTAGTTGCATTTACGTTATTAGTACAAAGCTCGGTCGGT