Homologs in group_241

Help

7 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_02140 FBDBKF_02140 87.4 Morganella morganii S1 ompR DNA-binding response regulator, OmpR family, contains REC and winged-helix (wHTH) domain
EHELCC_02610 EHELCC_02610 87.4 Morganella morganii S2 ompR DNA-binding response regulator, OmpR family, contains REC and winged-helix (wHTH) domain
NLDBIP_00850 NLDBIP_00850 87.4 Morganella morganii S4 ompR DNA-binding response regulator, OmpR family, contains REC and winged-helix (wHTH) domain
LHKJJB_01185 LHKJJB_01185 87.4 Morganella morganii S3 ompR DNA-binding response regulator, OmpR family, contains REC and winged-helix (wHTH) domain
HKOGLL_01225 HKOGLL_01225 87.4 Morganella morganii S5 ompR DNA-binding response regulator, OmpR family, contains REC and winged-helix (wHTH) domain
F4V73_RS03915 F4V73_RS03915 55.2 Morganella psychrotolerans - copper/silver response regulator transcription factor
F4V73_RS10180 F4V73_RS10180 32.3 Morganella psychrotolerans - response regulator transcription factor

Distribution of the homologs in the orthogroup group_241

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_241

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P76340 1.21e-103 301 64 0 216 1 hprR Transcriptional regulatory protein HprR Escherichia coli (strain K12)
Q44006 7.33e-84 251 56 2 223 2 czcR Transcriptional activator protein CzcR Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
P0ACZ8 1.56e-82 248 52 2 225 1 cusR Transcriptional regulatory protein CusR Escherichia coli (strain K12)
P0ACZ9 1.56e-82 248 52 2 225 3 cusR Transcriptional regulatory protein CusR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AD00 1.56e-82 248 52 2 225 3 cusR Transcriptional regulatory protein CusR Escherichia coli O157:H7
P0DMK7 1.89e-79 240 56 1 220 3 irlR Transcriptional activator protein IrlR Burkholderia pseudomallei (strain K96243)
I1WSZ4 1.89e-79 240 56 1 220 3 irlR Transcriptional activator protein IrlR Burkholderia pseudomallei (strain 1026b)
Q02540 1.33e-76 233 53 2 222 1 copR Transcriptional activator protein CopR Pseudomonas syringae pv. tomato
Q47456 6.53e-75 229 52 2 219 3 pcoR Transcriptional regulatory protein PcoR Escherichia coli
Q9ZHD3 1.46e-73 225 51 4 228 3 silR Probable transcriptional regulatory protein SilR Salmonella typhimurium
O34903 2.31e-58 186 44 2 219 3 ykoG Uncharacterized transcriptional regulatory protein YkoG Bacillus subtilis (strain 168)
P0C001 1.25e-50 166 41 1 215 3 arlR Response regulator ArlR Staphylococcus aureus (strain MW2)
Q6G9E6 1.25e-50 166 41 1 215 3 arlR Response regulator ArlR Staphylococcus aureus (strain MSSA476)
Q6GGZ3 1.25e-50 166 41 1 215 3 arlR Response regulator ArlR Staphylococcus aureus (strain MRSA252)
P0C000 1.25e-50 166 41 1 215 3 arlR Response regulator ArlR Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HG04 1.25e-50 166 41 1 215 3 arlR Response regulator ArlR Staphylococcus aureus (strain COL)
Q2YY03 1.25e-50 166 41 1 215 3 arlR Response regulator ArlR Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q9KJN4 1.25e-50 166 41 1 215 1 arlR Response regulator ArlR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FH23 1.25e-50 166 41 1 215 3 arlR Response regulator ArlR Staphylococcus aureus (strain USA300)
Q4L6C6 1.28e-50 166 41 1 215 3 arlR Response regulator ArlR Staphylococcus haemolyticus (strain JCSC1435)
Q49XM7 4.36e-48 160 42 1 215 3 arlR Response regulator ArlR Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
A1TEL7 6.06e-48 160 39 2 222 3 mprA Response regulator MprA Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
P13792 7.19e-48 160 41 3 234 1 phoP Alkaline phosphatase synthesis transcriptional regulatory protein PhoP Bacillus subtilis (strain 168)
Q99U73 1.63e-47 158 40 2 215 3 arlR Response regulator ArlR Staphylococcus aureus (strain N315)
Q7D9K0 1.8e-47 159 39 2 222 3 tcrA Transcriptional regulatory protein TcrA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
O07776 1.8e-47 159 39 2 222 1 tcrA Transcriptional regulatory protein TcrA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
A0R3I8 2.46e-47 158 40 2 221 1 mprA Response regulator MprA Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q9CD68 2.56e-47 158 38 2 221 3 mprA Response regulator MprA Mycobacterium leprae (strain TN)
Q742C1 4.59e-47 158 38 2 221 3 mprA Response regulator MprA Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
A0QBQ9 4.59e-47 158 38 2 221 3 mprA Response regulator MprA Mycobacterium avium (strain 104)
Q7A216 8.9e-47 157 39 2 230 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain MW2)
Q9RDT5 8.9e-47 157 39 2 230 1 walR Transcriptional regulatory protein WalR Staphylococcus aureus
A8YYU1 8.9e-47 157 39 2 230 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain USA300 / TCH1516)
Q6GD72 8.9e-47 157 39 2 230 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain MSSA476)
Q6GKS7 8.9e-47 157 39 2 230 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain MRSA252)
Q7A8E1 8.9e-47 157 39 2 230 1 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain N315)
Q99XF3 8.9e-47 157 39 2 230 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QD57 8.9e-47 157 39 2 230 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain Newman)
Q5HJX7 8.9e-47 157 39 2 230 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain COL)
Q2YUQ3 8.9e-47 157 39 2 230 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain bovine RF122 / ET3-1)
A5INQ9 8.9e-47 157 39 2 230 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain JH9)
Q2G2U6 8.9e-47 157 39 2 230 1 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FKN8 8.9e-47 157 39 2 230 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain USA300)
A6TXG8 8.9e-47 157 39 2 230 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain JH1)
A7WWQ5 8.9e-47 157 39 2 230 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain Mu3 / ATCC 700698)
A1KHB7 2.03e-46 156 38 2 221 3 mprA Response regulator MprA Mycobacterium bovis (strain BCG / Pasteur 1173P2)
Q7U0X4 2.03e-46 156 38 2 221 1 mprA Response regulator MprA Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q1B3X8 2.07e-46 156 38 2 221 3 mprA Response regulator MprA Mycobacterium sp. (strain MCS)
A1UL70 2.07e-46 156 38 2 221 3 mprA Response regulator MprA Mycobacterium sp. (strain KMS)
A3Q5L9 2.07e-46 156 38 2 221 3 mprA Response regulator MprA Mycobacterium sp. (strain JLS)
P9WGM9 2.46e-46 156 38 2 221 1 mprA Response regulator MprA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM8 2.46e-46 156 38 2 221 3 mprA Response regulator MprA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5U123 2.46e-46 156 38 2 221 3 mprA Response regulator MprA Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
Q8CQK0 3.4e-46 155 39 2 228 3 walR Transcriptional regulatory protein WalR Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HK18 3.4e-46 155 39 2 228 3 walR Transcriptional regulatory protein WalR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
L7N689 4.36e-46 156 40 3 227 1 trcR Transcriptional regulatory protein TrcR Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
A0PWB4 4.43e-46 155 37 2 223 3 mprA Response regulator MprA Mycobacterium ulcerans (strain Agy99)
Q4A160 5.36e-46 155 38 2 230 3 walR Transcriptional regulatory protein WalR Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q4LAJ9 5.47e-46 155 39 2 228 3 walR Transcriptional regulatory protein WalR Staphylococcus haemolyticus (strain JCSC1435)
P9WGM1 5.84e-45 152 41 2 210 1 prrA Transcriptional regulatory protein PrrA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM0 5.84e-45 152 41 2 210 3 prrA Transcriptional regulatory protein PrrA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0A5Z7 5.84e-45 152 41 2 210 3 prrA Transcriptional regulatory protein PrrA Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q7A0U4 9.06e-45 152 37 2 228 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain MW2)
Q9L524 9.06e-45 152 37 2 228 2 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus
Q6G972 9.06e-45 152 37 2 228 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain MSSA476)
Q6GGK6 9.06e-45 152 37 2 228 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain MRSA252)
Q7A5H6 9.06e-45 152 37 2 228 1 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain N315)
Q7A2R6 9.06e-45 152 37 2 228 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HFT0 9.06e-45 152 37 2 228 2 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain COL)
Q2FY79 9.06e-45 152 37 2 228 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q50136 1.08e-44 152 41 2 210 3 prrA Transcriptional regulatory protein PrrA Mycobacterium leprae (strain TN)
P9WGL9 3.45e-44 150 38 2 224 1 regX3 Sensory transduction protein RegX3 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGL8 3.45e-44 150 38 2 224 2 regX3 Sensory transduction protein RegX3 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
O07130 3.45e-44 150 38 2 224 1 regX3 Sensory transduction protein RegX3 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q5HPC3 4.28e-44 150 40 1 215 3 arlR Response regulator ArlR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q9F868 6.7e-44 149 37 2 225 1 regX3 Sensory transduction protein RegX3 Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q8CP82 9.12e-44 149 40 1 215 3 arlR Response regulator ArlR Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
P28835 2.47e-43 149 40 3 230 3 ycf27 Probable transcriptional regulator ycf27 Porphyridium aerugineum
P37478 3.18e-43 148 39 2 230 1 walR Transcriptional regulatory protein WalR Bacillus subtilis (strain 168)
Q8DPL7 4.76e-43 147 39 2 228 1 walR Transcriptional regulatory protein WalR Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
A0A0H2UQ68 4.76e-43 147 39 2 228 1 walR Transcriptional regulatory protein WalR Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
A0A0H2ZN37 4.76e-43 147 39 2 228 1 walR Transcriptional regulatory protein WalR Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
P28257 2.19e-42 146 40 3 230 3 ycf27 Probable transcriptional regulator ycf27 Galdieria sulphuraria
Q8XBS3 3.05e-42 145 39 3 221 2 qseB Transcriptional regulatory protein QseB Escherichia coli O157:H7
O78428 7.21e-42 145 39 3 230 3 ycf27 Probable transcriptional regulator ycf27 Guillardia theta
P45337 9.4e-42 144 39 4 227 3 qseB Transcriptional regulatory protein QseB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P52076 9.8e-42 144 39 3 221 2 qseB Transcriptional regulatory protein QseB Escherichia coli (strain K12)
P54884 1.71e-41 142 40 2 197 3 rgx3 Sensory transduction protein RegX3 Mycobacterium leprae (strain TN)
P35163 1.95e-41 144 36 2 228 1 resD Transcriptional regulatory protein ResD Bacillus subtilis (strain 168)
P94413 6.37e-41 142 37 3 226 3 yclJ Uncharacterized transcriptional regulatory protein YclJ Bacillus subtilis (strain 168)
P51358 6.46e-41 142 38 3 230 3 ycf27 Probable transcriptional regulator ycf27 Porphyra purpurea
Q1XDC9 7.76e-41 142 38 3 230 3 ycf27 Probable transcriptional regulator ycf27 Neopyropia yezoensis
P42244 1.12e-40 141 36 2 223 3 ycbL Uncharacterized transcriptional regulatory protein YcbL Bacillus subtilis (strain 168)
Q9I0I1 1.68e-40 140 37 3 220 1 carR Response regulator protein CarR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q8CN92 3.55e-40 140 34 1 221 3 hssR Heme response regulator HssR Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
P66795 4.51e-40 139 38 3 221 3 qseB Transcriptional regulatory protein QseB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P66796 4.51e-40 139 38 3 221 3 qseB Transcriptional regulatory protein QseB Salmonella typhi
P48259 1.6e-39 139 38 3 226 3 ycf27 Probable transcriptional regulator ycf27 Cyanophora paradoxa
P0AFJ5 1.98e-39 138 37 4 224 1 phoB Phosphate regulon transcriptional regulatory protein PhoB Escherichia coli (strain K12)
P0AFJ6 1.98e-39 138 37 4 224 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Escherichia coli O157:H7
P45606 2.16e-39 138 37 4 224 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Shigella dysenteriae
P45605 4.79e-39 137 37 4 224 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Klebsiella pneumoniae
Q5HLN2 5.14e-39 137 33 1 221 3 hssR Heme response regulator HssR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q52990 1.04e-38 136 38 2 223 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Rhizobium meliloti (strain 1021)
Q8FZ93 1.07e-38 136 36 3 226 1 ctrA Cell cycle response regulator CtrA Brucella suis biovar 1 (strain 1330)
B0CI76 1.07e-38 136 36 3 226 3 ctrA Cell cycle response regulator CtrA Brucella suis (strain ATCC 23445 / NCTC 10510)
A5VRW9 1.07e-38 136 36 3 226 1 ctrA Cell cycle response regulator CtrA Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q7CNV1 1.07e-38 136 36 3 226 1 ctrA Cell cycle response regulator CtrA Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
A9M708 1.07e-38 136 36 3 226 3 ctrA Cell cycle response regulator CtrA Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q9ZHS1 1.07e-38 136 36 3 226 1 ctrA Cell cycle response regulator CtrA Brucella abortus biovar 1 (strain 9-941)
Q2YQA4 1.07e-38 136 36 3 226 1 ctrA Cell cycle response regulator CtrA Brucella abortus (strain 2308)
B2S753 1.07e-38 136 36 3 226 3 ctrA Cell cycle response regulator CtrA Brucella abortus (strain S19)
P31079 1.67e-38 136 37 5 227 3 petR Protein PetR Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
P45607 1.69e-38 135 37 4 224 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Shigella flexneri
A6WZ81 1.83e-38 135 36 3 226 3 ctrA Cell cycle response regulator CtrA Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
Q47744 2.81e-38 135 34 1 218 3 vanRB Regulatory protein VanRB Enterococcus faecalis (strain ATCC 700802 / V583)
Q9TLQ4 2.89e-38 135 36 3 229 3 ycf27 Probable transcriptional regulator ycf27 Cyanidium caldarium
P0A4I0 4.42e-38 134 35 5 223 3 dltR Transcriptional regulatory protein DltR Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
P0A4H9 4.42e-38 134 35 5 223 3 dltR Transcriptional regulatory protein DltR Streptococcus agalactiae serotype III (strain NEM316)
P32040 1.28e-37 134 36 4 231 3 SYNPCC7002_A0851 Probable transcriptional regulatory protein SYNPCC7002_A0851 Picosynechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)
P39663 1.28e-37 134 36 4 232 1 sphR Alkaline phosphatase synthesis transcriptional regulatory protein SphR Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q9I4F9 1.39e-37 133 35 2 218 1 phoP Two-component response regulator PhoP Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q93CB8 1.47e-37 133 37 2 222 3 mtrA DNA-binding response regulator MtrA Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
P9WGM7 1.69e-37 133 37 2 222 1 mtrA DNA-binding response regulator MtrA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM6 1.69e-37 133 37 2 222 3 mtrA DNA-binding response regulator MtrA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0A5Z5 1.69e-37 133 37 2 222 3 mtrA DNA-binding response regulator MtrA Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
A0QTK2 2.31e-37 133 36 2 222 1 mtrA DNA-binding response regulator MtrA Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
P36556 3.27e-37 132 35 3 220 1 basR Transcriptional regulatory protein BasR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q9HV32 3.7e-37 132 35 4 224 1 pmrA Response regulator protein PmrA Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q82EB1 6.23e-37 132 36 2 232 3 cseB Transcriptional regulatory protein CseB Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q9CCJ2 7.2e-37 131 37 2 222 3 mtrA DNA-binding response regulator MtrA Mycobacterium leprae (strain TN)
P0CL17 1.03e-36 131 38 6 224 2 tctD Transcriptional regulatory protein TctD Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
E1WA34 1.03e-36 131 38 6 224 3 tctD Transcriptional regulatory protein TctD Salmonella typhimurium (strain SL1344)
Q9ZEP4 1.3e-36 131 36 2 231 1 cseB Transcriptional regulatory protein CseB Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
P30843 5.89e-36 129 37 4 221 1 basR Transcriptional regulatory protein BasR Escherichia coli (strain K12)
Q2YZ24 1.09e-35 128 31 1 219 3 hssR Heme response regulator HssR Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q49ZT8 1.26e-35 128 31 1 217 3 hssR Heme response regulator HssR Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q7A039 1.63e-35 128 31 1 219 3 hssR Heme response regulator HssR Staphylococcus aureus (strain MW2)
A8Z552 1.63e-35 128 31 1 219 3 hssR Heme response regulator HssR Staphylococcus aureus (strain USA300 / TCH1516)
Q6G6V9 1.63e-35 128 31 1 219 3 hssR Heme response regulator HssR Staphylococcus aureus (strain MSSA476)
Q7A3X1 1.63e-35 128 31 1 219 3 hssR Heme response regulator HssR Staphylococcus aureus (strain N315)
Q99RR6 1.63e-35 128 31 1 219 3 hssR Heme response regulator HssR Staphylococcus aureus (strain Mu50 / ATCC 700699)
A5IVE2 1.63e-35 128 31 1 219 3 hssR Heme response regulator HssR Staphylococcus aureus (strain JH9)
Q2FVQ9 1.63e-35 128 31 1 219 3 hssR Heme response regulator HssR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FED5 1.63e-35 128 31 1 219 3 hssR Heme response regulator HssR Staphylococcus aureus (strain USA300)
A6U488 1.63e-35 128 31 1 219 3 hssR Heme response regulator HssR Staphylococcus aureus (strain JH1)
A7X5Y5 1.63e-35 128 31 1 219 3 hssR Heme response regulator HssR Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q6GE73 1.86e-35 128 31 1 219 3 hssR Heme response regulator HssR Staphylococcus aureus (strain MRSA252)
Q06239 2.04e-35 128 33 3 228 3 vanR Regulatory protein VanR Enterococcus faecium
A6QJK3 3.81e-35 127 31 1 219 1 hssR Heme response regulator HssR Staphylococcus aureus (strain Newman)
Q5HDJ4 3.81e-35 127 31 1 219 3 hssR Heme response regulator HssR Staphylococcus aureus (strain COL)
Q04942 5.34e-35 127 39 2 223 1 afsQ1 Transcriptional regulatory protein AfsQ1 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
O69730 6.25e-35 127 36 3 221 1 tcrX Probable transcriptional regulatory protein TcrX Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
B8H358 2.07e-34 125 35 3 224 3 ctrA Cell cycle transcriptional regulator CtrA Caulobacter vibrioides (strain NA1000 / CB15N)
P0CAW8 2.07e-34 125 35 3 224 3 ctrA Cell cycle transcriptional regulator CtrA Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q4L8L9 2.8e-34 125 31 1 219 3 hssR Heme response regulator HssR Staphylococcus haemolyticus (strain JCSC1435)
P0A4H8 4.64e-34 124 33 3 220 3 ciaR Transcriptional regulatory protein CiaR Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P0A4H7 4.64e-34 124 33 3 220 3 ciaR Transcriptional regulatory protein CiaR Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
G3XCY6 9.45e-34 124 37 4 226 1 gltR Transcriptional regulatory protein GltR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q7A1J1 1.96e-33 122 30 4 224 3 saeR Response regulator SaeR Staphylococcus aureus (strain MW2)
Q6GBC4 1.96e-33 122 30 4 224 3 saeR Response regulator SaeR Staphylococcus aureus (strain MSSA476)
Q6GIT6 1.96e-33 122 30 4 224 3 saeR Response regulator SaeR Staphylococcus aureus (strain MRSA252)
Q7A6V3 1.96e-33 122 30 4 224 1 saeR Response regulator SaeR Staphylococcus aureus (strain N315)
Q99VR7 1.96e-33 122 30 4 224 3 saeR Response regulator SaeR Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q840P8 1.96e-33 122 30 4 224 1 saeR Response regulator SaeR Staphylococcus aureus (strain Newman)
Q5HHW4 1.96e-33 122 30 4 224 1 saeR Response regulator SaeR Staphylococcus aureus (strain COL)
Q2YSM5 1.96e-33 122 30 4 224 3 saeR Response regulator SaeR Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q2G2G2 1.96e-33 122 30 4 224 1 saeR Response regulator SaeR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FIT4 1.96e-33 122 30 4 224 3 saeR Response regulator SaeR Staphylococcus aureus (strain USA300)
Q70FH0 4.05e-33 122 34 3 224 3 pmrA Transcriptional regulatory protein PmrA Pectobacterium parmentieri
O32192 1.7e-32 120 37 6 223 1 cssR Transcriptional regulatory protein CssR Bacillus subtilis (strain 168)
P0A4I2 2.29e-32 119 35 3 220 3 cutR Transcriptional regulatory protein CutR Streptomyces lividans
P0A4I1 2.29e-32 119 35 3 220 3 cutR Transcriptional regulatory protein CutR Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q9AE24 2.38e-32 120 32 3 227 3 rprY Transcriptional regulatory protein RprY Bacteroides fragilis (strain YCH46)
Q57QC3 3.78e-32 119 33 2 218 3 phoP Virulence transcriptional regulatory protein PhoP Salmonella choleraesuis (strain SC-B67)
P23620 6.22e-32 119 34 3 222 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q55933 8.26e-32 119 33 6 233 1 rppA Response regulator RppA Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P94504 8.52e-32 119 33 5 224 3 yvrH Transcriptional regulatory protein YvrH Bacillus subtilis (strain 168)
Q8Z7H2 1.08e-31 118 32 2 218 3 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhi
P0DM78 1.55e-31 117 32 2 218 1 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
F5ZP95 1.55e-31 117 32 2 218 1 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhimurium (strain ATCC 68169 / UK-1)
E1WFA1 1.55e-31 117 32 2 218 2 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhimurium (strain SL1344)
D0ZV90 1.55e-31 117 32 2 218 1 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhimurium (strain 14028s / SGSC 2262)
Q5PMJ1 1.55e-31 117 32 2 218 3 phoP Virulence transcriptional regulatory protein PhoP Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q8CQ17 5.8e-31 116 32 5 225 1 saeR Response regulator SaeR Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HR28 5.8e-31 116 32 5 225 3 saeR Response regulator SaeR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
P9WGN1 8.17e-31 116 32 2 222 1 kdpE Transcriptional regulatory protein KdpE Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGN0 8.17e-31 116 32 2 222 3 kdpE Transcriptional regulatory protein KdpE Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q55890 8.61e-31 116 35 4 228 1 rpaA DNA-binding dual master transcriptional regulator RpaA Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q9KM23 8.88e-31 116 39 4 205 1 vxrB Transcriptional regulatory protein VxrB Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P21866 1.45e-30 115 32 2 221 1 kdpE KDP operon transcriptional regulatory protein KdpE Escherichia coli (strain K12)
A0A4P7TS68 1.81e-30 115 32 3 225 1 ompR DNA-binding dual transcriptional regulator OmpR Shigella flexneri serotype 5a (strain M90T)
P0AA21 1.81e-30 115 32 3 225 3 ompR DNA-binding dual transcriptional regulator OmpR Shigella flexneri
P0AA19 1.81e-30 115 32 3 225 3 ompR DNA-binding dual transcriptional regulator OmpR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
A0A0H3NGY1 1.81e-30 115 32 3 225 3 ompR DNA-binding dual transcriptional regulator OmpR Salmonella typhimurium (strain SL1344)
P0AA20 1.81e-30 115 32 3 225 1 ompR DNA-binding dual transcriptional regulator OmpR Salmonella typhi
P0AA16 1.81e-30 115 32 3 225 1 ompR DNA-binding dual transcriptional regulator OmpR Escherichia coli (strain K12)
P0AA17 1.81e-30 115 32 3 225 3 ompR DNA-binding dual transcriptional regulator OmpR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AA18 1.81e-30 115 32 3 225 3 ompR DNA-binding dual transcriptional regulator OmpR Escherichia coli O157:H7
Q01473 5.04e-30 120 35 5 227 3 rcaC Protein RcaC Microchaete diplosiphon
P45189 8.03e-30 113 32 3 222 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q31S42 1.16e-29 113 35 3 230 1 rpaA DNA-binding dual master transcriptional regulator RpaA Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
A0A0H3GGB5 1.48e-29 113 34 3 225 2 cpxR Transcriptional regulatory protein CpxR Klebsiella pneumoniae subsp. pneumoniae (strain HS11286)
P23836 2.03e-29 112 30 2 218 1 phoP Transcriptional regulatory protein PhoP Escherichia coli (strain K12)
Q83RR0 2.21e-29 112 30 2 218 3 phoP Virulence transcriptional regulatory protein PhoP Shigella flexneri
Q8CXZ9 2.21e-29 112 30 2 218 3 phoP Transcriptional regulatory protein PhoP Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P54443 2.33e-29 112 35 5 227 3 yrkP Uncharacterized transcriptional regulatory protein YrkP Bacillus subtilis (strain 168)
P0AE90 2.51e-29 112 35 3 225 3 cpxR Transcriptional regulatory protein CpxR Shigella flexneri
P0AE88 2.51e-29 112 35 3 225 1 cpxR Transcriptional regulatory protein CpxR Escherichia coli (strain K12)
P0AE89 2.51e-29 112 35 3 225 3 cpxR Transcriptional regulatory protein CpxR Escherichia coli O157:H7
P58357 3.41e-29 112 35 6 226 3 torR TorCAD operon transcriptional regulatory protein TorR Escherichia coli O157:H7
P38684 4.26e-29 111 35 6 226 1 torR TorCAD operon transcriptional regulatory protein TorR Escherichia coli (strain K12)
P0A9Q4 4.57e-29 112 33 3 227 3 arcA Aerobic respiration control protein ArcA Shigella flexneri
P0A9Q1 4.57e-29 112 33 3 227 1 arcA Aerobic respiration control protein ArcA Escherichia coli (strain K12)
P0A9Q2 4.57e-29 112 33 3 227 3 arcA Aerobic respiration control protein ArcA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0A9Q3 4.57e-29 112 33 3 227 3 arcA Aerobic respiration control protein ArcA Escherichia coli O157:H7
P44918 6.68e-29 111 32 4 227 3 arcA Aerobic respiration control protein ArcA homolog Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q8X738 1.31e-28 110 30 2 218 3 phoP Transcriptional regulatory protein PhoP Escherichia coli O157:H7
Q07783 4.55e-28 109 33 3 236 3 chvI Transcriptional regulatory protein ChvI Rhizobium radiobacter
P50350 3.99e-27 107 32 3 235 3 chvI Transcriptional regulatory protein ChvI Rhizobium meliloti (strain 1021)
O24973 1.07e-26 105 34 2 222 1 arsR Transcriptional regulatory protein ArsR Helicobacter pylori (strain ATCC 700392 / 26695)
O31432 1.07e-26 105 33 7 221 3 ybdJ Uncharacterized transcriptional regulatory protein YbdJ Bacillus subtilis (strain 168)
P42421 2.3e-26 104 30 1 223 3 yxdJ Transcriptional regulatory protein YxdJ Bacillus subtilis (strain 168)
Q8GP20 2.89e-26 103 32 5 225 1 rssB Swarming motility regulation protein RssB Serratia marcescens
P50351 4.36e-26 104 32 3 237 3 chvI Transcriptional regulatory protein ChvI Sinorhizobium fredii (strain NBRC 101917 / NGR234)
O06978 9.2e-26 103 29 3 227 3 yvcP Uncharacterized transcriptional regulatory protein YvcP Bacillus subtilis (strain 168)
Q04803 1.13e-25 104 33 2 221 3 pfeR Transcriptional activator protein PfeR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P69228 5.09e-25 101 31 4 221 1 baeR Transcriptional regulatory protein BaeR Escherichia coli (strain K12)
P69229 5.09e-25 101 31 4 221 1 baeR Transcriptional regulatory protein BaeR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P08368 7.64e-25 100 32 3 221 1 creB Transcriptional regulatory protein CreB Escherichia coli (strain K12)
P44895 1.09e-24 100 34 6 228 3 cpxR Transcriptional regulatory protein CpxR homolog Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q4L481 1.66e-24 99 30 3 221 3 graR Response regulator protein GraR Staphylococcus haemolyticus (strain JCSC1435)
Q44929 4.64e-24 99 30 4 227 3 gtcR Response regulator GtcR Aneurinibacillus migulanus
Q2YSS2 5.22e-23 95 30 1 220 3 graR Response regulator protein GraR Staphylococcus aureus (strain bovine RF122 / ET3-1)
A8Z181 5.74e-23 95 30 1 220 3 graR Response regulator protein GraR Staphylococcus aureus (strain USA300 / TCH1516)
A6QEW8 5.74e-23 95 30 1 220 3 graR Response regulator protein GraR Staphylococcus aureus (strain Newman)
Q5HI09 5.74e-23 95 30 1 220 1 graR Response regulator protein GraR Staphylococcus aureus (strain COL)
Q2G0E0 5.74e-23 95 30 1 220 1 graR Response regulator protein GraR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FIY0 5.74e-23 95 30 1 220 3 graR Response regulator protein GraR Staphylococcus aureus (strain USA300)
Q6GJ11 6.04e-23 95 30 1 220 3 graR Response regulator protein GraR Staphylococcus aureus (strain MRSA252)
Q7A1L2 7.86e-23 95 30 1 220 3 graR Response regulator protein GraR Staphylococcus aureus (strain MW2)
Q6GBH1 7.86e-23 95 30 1 220 3 graR Response regulator protein GraR Staphylococcus aureus (strain MSSA476)
Q99VW2 7.86e-23 95 30 1 220 3 graR Response regulator protein GraR Staphylococcus aureus (strain N315)
A5IQL2 7.86e-23 95 30 1 220 3 graR Response regulator protein GraR Staphylococcus aureus (strain JH9)
A6TZD6 7.86e-23 95 30 1 220 3 graR Response regulator protein GraR Staphylococcus aureus (strain JH1)
A7WZC3 7.86e-23 95 30 1 220 3 graR Response regulator protein GraR Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q932F1 1.01e-22 95 30 1 220 1 graR Response regulator protein GraR Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q8DN02 3.35e-22 93 30 3 221 1 rr06 Response regulator RR06 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
A0A0H2ZNF6 3.35e-22 93 30 3 221 1 rr06 Response regulator RR06 Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
P55701 5.85e-22 93 29 2 205 4 NGR_a00800 Probable transcriptional regulatory protein y4xI Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q8CQ37 1.95e-21 91 30 4 221 3 graR Response regulator protein GraR Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HR81 1.95e-21 91 30 4 221 3 graR Response regulator protein GraR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
P07545 2.9e-21 91 39 6 169 3 virG Regulatory protein VirG Agrobacterium fabrum (strain C58 / ATCC 33970)
P33112 3.04e-21 90 33 4 221 3 spaR Transcriptional regulatory protein SpaR Bacillus subtilis
Q9HUI2 4.05e-21 91 29 5 230 3 aruR Transcriptional regulatory protein AruR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q07597 8.25e-21 90 28 2 224 3 nisR Nisin biosynthesis regulatory protein NisR Lactococcus lactis subsp. lactis
P52108 1.01e-20 90 29 3 228 1 rstA Transcriptional regulatory protein RstA Escherichia coli (strain K12)
O34951 2.02e-20 89 31 8 225 3 bceR Sensory transduction protein BceR Bacillus subtilis (strain 168)
Q9K621 4.42e-20 88 31 6 223 3 bceR Sensory transduction protein BceR Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
P13359 1.36e-19 87 37 6 178 3 virG Regulatory protein VirG Rhizobium rhizogenes
Q49VK3 1.38e-19 86 29 4 221 3 graR Response regulator protein GraR Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q2FWH6 5.53e-19 85 29 5 223 1 kdpE Transcriptional regulatory protein KdpE Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q1XDE4 6.25e-19 84 35 3 158 3 ycf29 Probable transcriptional regulator ycf29 Neopyropia yezoensis
Q44444 1.34e-18 84 37 6 169 3 virG Regulatory protein VirG Rhizobium radiobacter
P62722 1.44e-18 84 37 6 169 3 virG Regulatory protein VirG Agrobacterium tumefaciens (strain 15955)
O25918 1.69e-17 80 29 6 222 3 crdR Transcriptional regulatory protein CrdR Helicobacter pylori (strain ATCC 700392 / 26695)
B8GZM2 4.5e-16 79 36 1 118 1 pleD Response regulator PleD Caulobacter vibrioides (strain NA1000 / CB15N)
B8GZM2 0.000129 45 26 3 120 1 pleD Response regulator PleD Caulobacter vibrioides (strain NA1000 / CB15N)
Q9A5I5 4.5e-16 79 36 1 118 1 pleD Response regulator PleD Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q9A5I5 0.000129 45 26 3 120 1 pleD Response regulator PleD Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
P46384 7.28e-15 72 31 1 127 1 pilG Protein PilG Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P72781 3.21e-14 72 34 2 126 1 rre1 Response regulator Rre1 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P40138 1.85e-13 71 35 2 119 1 cyaB Adenylate cyclase 2 Stigmatella aurantiaca
Q05943 2.46e-13 70 38 1 95 3 glnR Transcriptional regulatory protein GlnR Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
T2KMF4 7.25e-13 70 27 4 168 3 BN863_21930 Histidine kinase P4 Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1)
Q06065 3.55e-12 68 31 3 132 1 atoC Regulatory protein AtoC Escherichia coli (strain K12)
P51343 1.07e-11 65 38 2 114 3 ycf29 Probable transcriptional regulator ycf29 Porphyra purpurea
Q9HV27 1.24e-11 66 36 3 121 1 PA4781 Cyclic di-GMP phosphodiesterase PA4781 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P51586 2.06e-11 62 32 1 116 3 None Uncharacterized 14.6 kDa protein in sodA1 3'region Leptolyngbya boryana
P43501 6.22e-11 61 30 1 113 3 pilH Protein PilH Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q54YH4 1.18e-10 64 29 1 124 1 dhkB Hybrid signal transduction histidine kinase B Dictyostelium discoideum
Q54SP4 1.4e-10 63 32 2 121 2 dhkD Hybrid signal transduction histidine kinase D Dictyostelium discoideum
Q9KSB1 1.6e-10 63 30 2 121 1 VC_1348 Probable cyclic di-GMP phosphodiesterase VC_1348 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q8KIY1 1.91e-10 63 29 4 165 1 tmoS Sensor histidine kinase TmoS Pseudomonas mendocina
A5VW00 2.04e-10 62 25 5 217 3 ftcR Flagellar transcriptional regulator FtcR Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q8FUS8 2.35e-10 61 25 5 217 3 ftcR Flagellar transcriptional regulator FtcR Brucella suis biovar 1 (strain 1330)
Q8YDL7 2.35e-10 61 25 5 217 1 ftcR Flagellar transcriptional regulator FtcR Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q576I4 2.35e-10 61 25 5 217 3 ftcR Flagellar transcriptional regulator FtcR Brucella abortus biovar 1 (strain 9-941)
Q2YJF8 2.35e-10 61 25 5 217 3 ftcR Flagellar transcriptional regulator FtcR Brucella abortus (strain 2308)
Q2KCH7 5.01e-10 58 31 3 117 3 cheY Probable chemotaxis protein CheY Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
P58402 5.29e-10 62 30 4 173 3 evgS Sensor protein EvgS Escherichia coli O157:H7
P30855 6.03e-10 62 30 4 173 1 evgS Sensor protein EvgS Escherichia coli (strain K12)
P48359 6.09e-10 60 30 3 144 3 ycf29 Probable transcriptional regulator ycf29 Cyanophora paradoxa
P14375 1.32e-09 60 30 1 122 1 zraR Transcriptional regulatory protein ZraR Escherichia coli (strain K12)
P0AE69 1.32e-09 57 33 2 111 3 cheY Chemotaxis protein CheY Shigella flexneri
P0AE67 1.32e-09 57 33 2 111 1 cheY Chemotaxis protein CheY Escherichia coli (strain K12)
Q8FGP6 1.32e-09 57 33 2 111 3 cheY Chemotaxis protein CheY Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AE68 1.32e-09 57 33 2 111 3 cheY Chemotaxis protein CheY Escherichia coli O157:H7
P0A2D5 2.29e-09 57 35 3 111 1 cheY Chemotaxis protein CheY Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2D6 2.29e-09 57 35 3 111 3 cheY Chemotaxis protein CheY Salmonella typhi
Q9KQD5 2.49e-09 57 31 3 113 1 VC_2065 Chemotaxis protein CheY-3 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A0A0H3AMJ9 2.49e-09 57 31 3 113 1 cheY-3 Chemotaxis protein CheY-3 Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
O05251 2.52e-09 58 28 3 153 3 malR Transcriptional regulatory protein MalR Bacillus subtilis (strain 168)
Q54Q69 2.69e-09 60 31 2 113 3 dhkG Hybrid signal transduction histidine kinase G Dictyostelium discoideum
E0X9C7 5.04e-09 59 28 4 165 1 todS Sensor histidine kinase TodS Pseudomonas putida (strain DOT-T1E)
Q8X613 5.18e-09 58 30 1 114 3 zraR Transcriptional regulatory protein ZraR Escherichia coli O157:H7
Q9FAD7 7.03e-09 55 32 2 111 3 cheY Chemotaxis protein CheY Enterobacter cloacae
G7WMP8 7.54e-09 56 32 4 116 1 filR2 Probable methanogenesis regulatory protein FilR2 Methanothrix harundinacea (strain 6Ac)
O25153 7.61e-09 58 30 3 122 1 cheAY Sensor histidine kinase CheAY Helicobacter pylori (strain ATCC 700392 / 26695)
Q2ILG8 8.64e-09 58 36 0 76 3 cheB6 Protein-glutamate methylesterase/protein-glutamine glutaminase 6 Anaeromyxobacter dehalogenans (strain 2CP-C)
Q9ZCY9 1.3e-08 57 28 3 149 3 RP562 Putative response regulator NtrX-like Rickettsia prowazekii (strain Madrid E)
P39486 1.51e-08 56 28 7 175 3 dctR Probable C4-dicarboxylate response regulator DctR Priestia megaterium
Q9APD9 1.58e-08 57 33 1 106 3 zraR Transcriptional regulatory protein ZraR Klebsiella oxytoca
Q68WH4 1.58e-08 57 27 3 149 3 RT0550 Putative response regulator NtrX-like Rickettsia typhi (strain ATCC VR-144 / Wilmington)
Q9I4N3 1.91e-08 57 34 1 108 1 fleR Response regulator protein FleR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q8D0P1 2e-08 54 30 2 111 3 cheY Chemotaxis protein CheY Yersinia pestis
A5W4E3 2.33e-08 57 27 4 165 1 todS Sensor histidine kinase TodS Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
P0C5S5 2.37e-08 57 30 1 113 3 luxO Luminescence regulatory protein LuxO Vibrio harveyi
A7MVC2 2.37e-08 57 30 1 113 1 luxO Luminescence regulatory protein LuxO Vibrio campbellii (strain ATCC BAA-1116)
Q87MX7 2.99e-08 56 30 1 113 3 luxO Regulatory protein LuxO Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
A6X580 3.02e-08 53 30 1 116 3 divK Polar-differentiation response regulator DivK Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
P9WGM3 3.27e-08 55 29 3 127 1 pdtaR Transcriptional regulatory protein PdtaR Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM2 3.27e-08 55 29 3 127 3 pdtaR Transcriptional regulatory protein PdtaR Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q8FW53 3.38e-08 53 30 1 116 3 divK Polar-differentiation response regulator DivK Brucella suis biovar 1 (strain 1330)
A9WYT1 3.38e-08 53 30 1 116 3 divK Polar-differentiation response regulator DivK Brucella suis (strain ATCC 23445 / NCTC 10510)
A5VUU3 3.38e-08 53 30 1 116 3 divK Polar-differentiation response regulator DivK Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q8YC73 3.38e-08 53 30 1 116 3 divK Polar-differentiation response regulator DivK Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
A9MBQ2 3.38e-08 53 30 1 116 3 divK Polar-differentiation response regulator DivK Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q7BBW0 3.38e-08 53 30 1 116 1 divK Polar-differentiation response regulator DivK Brucella abortus biovar 1 (strain 9-941)
Q2YKN1 3.38e-08 53 30 1 116 3 divK Polar-differentiation response regulator DivK Brucella abortus (strain 2308)
B2SB45 3.38e-08 53 30 1 116 3 divK Polar-differentiation response regulator DivK Brucella abortus (strain S19)
Q4UL27 3.67e-08 56 26 3 149 3 RF_0895 Putative response regulator NtrX-like Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
Q54YZ9 3.81e-08 56 28 1 126 3 dhkJ Hybrid signal transduction histidine kinase J Dictyostelium discoideum
P0C0F6 3.96e-08 56 31 3 114 1 rpfC Sensory/regulatory protein RpfC Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
P18769 4.66e-08 56 28 1 118 1 frzE Gliding motility regulatory protein Myxococcus xanthus
Q9K998 4.72e-08 55 35 3 112 3 dctR Probable C4-dicarboxylate response regulator DctR Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q7MM78 4.86e-08 56 30 1 113 3 luxO Regulatory protein LuxO Vibrio vulnificus (strain YJ016)
Q8CWJ5 4.86e-08 56 30 1 113 3 luxO Regulatory protein LuxO Vibrio vulnificus (strain CMCP6)
P41789 5.12e-08 56 30 2 119 1 glnG DNA-binding transcriptional regulator NtrC Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0AEC4 5.17e-08 56 31 2 116 3 arcB Aerobic respiration control sensor protein ArcB Shigella flexneri
P0AEC3 5.17e-08 56 31 2 116 1 arcB Aerobic respiration control sensor protein ArcB Escherichia coli (strain K12)
Q86AT9 5.21e-08 56 29 2 124 3 dhkI-1 Hybrid signal transduction histidine kinase I Dictyostelium discoideum
P58363 5.27e-08 56 31 2 116 3 arcB Aerobic respiration control sensor protein ArcB Escherichia coli O157:H7
Q8Z333 5.57e-08 55 30 1 106 3 zraR Transcriptional regulatory protein ZraR Salmonella typhi
P25852 5.79e-08 55 30 1 106 1 zraR Transcriptional regulatory protein ZraR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0C0F7 5.8e-08 56 31 3 114 1 rpfC Sensory/regulatory protein RpfC Xanthomonas campestris pv. campestris (strain 8004)
Q5A599 6.24e-08 56 28 2 132 1 NIK1 Histidine protein kinase NIK1 Candida albicans (strain SC5314 / ATCC MYA-2876)
P23221 6.64e-08 54 26 4 179 3 fixJ Transcriptional regulatory protein FixJ Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q8H7S7 6.97e-08 55 30 1 109 2 RR21 Two-component response regulator ORR21 Oryza sativa subsp. japonica
A2XE31 6.97e-08 55 30 1 109 3 RR21 Two-component response regulator ORR21 Oryza sativa subsp. indica
P0AFB8 8.71e-08 55 30 2 119 1 glnG DNA-binding transcriptional regulator NtrC Escherichia coli (strain K12)
P0AFB9 8.71e-08 55 30 2 119 3 glnG DNA-binding transcriptional regulator NtrC Escherichia coli O157:H7
Q1RJS1 1.02e-07 55 27 2 136 3 RBE_0312 Putative response regulator NtrX-like Rickettsia bellii (strain RML369-C)
Q5A4X5 1.07e-07 55 30 1 108 3 SKN7 Transcription factor SKN7 Candida albicans (strain SC5314 / ATCC MYA-2876)
Q10WZ6 1.3e-07 54 30 6 146 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Trichodesmium erythraeum (strain IMS101)
Q9KT84 1.44e-07 54 29 1 113 1 luxO Regulatory protein LuxO Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q51455 1.51e-07 52 27 2 116 3 cheY Chemotaxis protein CheY Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q93P00 1.52e-07 52 29 2 111 3 cheY Chemotaxis protein CheY Yersinia enterocolitica
P52936 2.34e-07 53 34 4 101 3 spo0A Stage 0 sporulation protein A homolog Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
A2XYV5 2.35e-07 52 30 5 123 2 RR6 Two-component response regulator ORR6 Oryza sativa subsp. indica
Q7XQA6 2.49e-07 52 30 5 123 2 RR6 Two-component response regulator ORR6 Oryza sativa subsp. japonica
O29221 2.78e-07 53 27 4 148 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
P06534 2.82e-07 53 29 2 118 1 spo0A Stage 0 sporulation protein A Bacillus subtilis (strain 168)
P52938 2.84e-07 53 32 2 117 3 spo0A Stage 0 sporulation protein A homolog Clostridioides difficile
O49397 2.9e-07 53 31 1 109 1 ARR10 Two-component response regulator ARR10 Arabidopsis thaliana
Q9HU19 3.16e-07 53 31 5 142 3 dctD C4-dicarboxylate transport transcriptional regulatory protein DctD Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P52942 3.35e-07 50 26 1 118 3 spo0F Sporulation initiation phosphotransferase F Bacillus thuringiensis subsp. kurstaki
P38889 3.98e-07 53 29 1 106 1 SKN7 Transcription factor SKN7 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q9SXL4 4.67e-07 53 38 1 62 1 AHK1 Histidine kinase 1 Arabidopsis thaliana
P96126 4.69e-07 51 30 3 119 3 cheY Chemotaxis protein CheY Treponema pallidum (strain Nichols)
P52940 5.05e-07 52 36 3 96 3 spo0A Stage 0 sporulation protein A homolog Clostridium pasteurianum
Q869S5 6.09e-07 53 29 3 122 1 dokA Hybrid signal transduction protein dokA Dictyostelium discoideum
P52941 6.25e-07 52 27 3 128 3 spo0A Stage 0 sporulation protein A homolog Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
P44845 6.98e-07 51 31 2 115 3 narP Nitrate/nitrite response regulator protein homolog Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P03029 7.76e-07 52 31 2 119 1 ntrC DNA-binding transcriptional regulator NtrC Klebsiella pneumoniae
P0AEV3 7.86e-07 52 32 1 101 3 rssB Regulator of RpoS Shigella flexneri
P0AEV1 7.86e-07 52 32 1 101 1 rssB Regulator of RpoS Escherichia coli (strain K12)
P0AEV2 7.86e-07 52 32 1 101 3 rssB Regulator of RpoS Escherichia coli O157:H7
Q4UU85 8.7e-07 52 38 1 81 1 rpfG Cyclic di-GMP phosphodiesterase response regulator RpfG Xanthomonas campestris pv. campestris (strain 8004)
A7N6S2 9.21e-07 52 31 1 115 1 cqsS CAI-1 autoinducer sensor kinase/phosphatase CqsS Vibrio campbellii (strain ATCC BAA-1116)
Q92HC2 9.74e-07 52 25 2 136 3 RC0849 Putative response regulator NtrX-like Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Q9WY30 9.94e-07 52 30 2 117 1 TM_0186 Cyclic di-GMP phosphodiesterase TM_0186 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
O14283 1.09e-06 52 32 1 102 1 prr1 Transcription factor prr1 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
P62598 1.15e-06 52 31 1 109 2 ARR12 Two-component response regulator ARR12 Arabidopsis thaliana
Q54RP6 1.19e-06 52 29 3 133 3 dhkL Hybrid signal transduction histidine kinase L Dictyostelium discoideum
P10577 1.25e-06 52 26 1 107 1 ntrC DNA-binding transcriptional regulator NtrC Rhizobium meliloti (strain 1021)
P23747 1.47e-06 51 31 1 119 1 algB Alginate biosynthesis transcriptional regulatory protein AlgB Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q6K9T0 1.58e-06 49 26 3 117 2 RR3 Two-component response regulator ORR3 Oryza sativa subsp. japonica
Q4GZK8 1.58e-06 49 26 3 117 2 RR3 Two-component response regulator ORR3 Oryza sativa subsp. indica
P26487 1.62e-06 50 34 2 98 3 fixJ Transcriptional regulatory protein FixJ Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
Q9KL96 1.68e-06 50 35 4 109 3 VC_A0850 Uncharacterized response regulatory protein VC_A0850 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A1W0A5 1.75e-06 49 27 3 122 3 cheY Chemotaxis protein CheY homolog Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
P0C635 1.75e-06 49 27 3 122 3 cheY Chemotaxis protein CheY homolog Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
A8FMH1 1.75e-06 49 27 3 122 3 cheY Chemotaxis protein CheY homolog Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
Q88AQ2 1.84e-06 51 31 1 119 3 algB Alginate biosynthesis transcriptional regulatory protein AlgB Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
P59342 1.85e-06 51 28 2 118 3 barA Signal transduction histidine-protein kinase BarA Shigella flexneri
Q5SML5 1.94e-06 51 30 1 109 2 RR22 Two-component response regulator ORR22 Oryza sativa subsp. japonica
B8B3I4 1.94e-06 51 30 1 109 3 RR22 Two-component response regulator ORR22 Oryza sativa subsp. indica
P0AEC5 1.98e-06 51 28 2 118 1 barA Signal transduction histidine-protein kinase BarA Escherichia coli (strain K12)
P0AEC6 1.98e-06 51 28 2 118 1 barA Signal transduction histidine-protein kinase BarA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AEC7 1.98e-06 51 28 2 118 3 barA Signal transduction histidine-protein kinase BarA Escherichia coli O157:H7
Q56128 2.04e-06 51 26 1 108 3 rcsC Sensor histidine kinase RcsC Salmonella typhi
P0DMC5 2.06e-06 51 27 1 105 1 rcsC Sensor histidine kinase RcsC Escherichia coli (strain K12)
Q88RJ6 2.28e-06 51 30 1 119 3 algB Alginate biosynthesis transcriptional regulatory protein AlgB Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
P96686 2.59e-06 50 29 3 121 3 ydfI Transcriptional regulatory protein YdfI Bacillus subtilis (strain 168)
Q6H468 2.59e-06 48 30 3 116 2 RR11 Two-component response regulator ORR11 Oryza sativa subsp. japonica
B8AFR8 2.59e-06 48 30 3 116 3 RR11 Two-component response regulator ORR11 Oryza sativa subsp. indica
P71403 2.8e-06 48 27 3 110 1 cheY1 Chemotaxis protein CheY1 Helicobacter pylori (strain ATCC 700392 / 26695)
Q9M9B9 3.02e-06 50 26 3 126 2 ARR19 Putative two-component response regulator ARR19 Arabidopsis thaliana
Q54SK5 3.4e-06 50 29 3 122 3 dhkM Hybrid signal transduction histidine kinase M Dictyostelium discoideum
A2YFR6 3.57e-06 50 24 1 140 3 HK1 Probable histidine kinase 1 Oryza sativa subsp. indica
P58662 3.63e-06 50 26 1 105 3 rcsC Sensor histidine kinase RcsC Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q53228 3.66e-06 49 27 1 106 1 regA Photosynthetic apparatus regulatory protein RegA Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
Q551X9 3.81e-06 50 26 1 123 3 dhkF Hybrid signal transduction histidine kinase F Dictyostelium discoideum
A3BE68 3.85e-06 50 24 1 140 2 HK1 Probable histidine kinase 1 Oryza sativa subsp. japonica
P52929 3.92e-06 49 28 1 105 3 spo0A Stage 0 sporulation protein A (Fragment) Brevibacillus parabrevis
P0DMC6 4.01e-06 50 28 2 107 1 rcsC Sensor histidine kinase RcsC Escherichia coli
Q9ZM64 4.56e-06 47 27 3 110 3 cheY1 Chemotaxis protein CheY1 Helicobacter pylori (strain J99 / ATCC 700824)
A2X1N2 4.78e-06 50 30 1 109 3 RR24 Two-component response regulator ORR24 Oryza sativa subsp. indica
Q6H805 5.19e-06 50 30 1 109 2 RR24 Two-component response regulator ORR24 Oryza sativa subsp. japonica
Q2HWH1 5.25e-06 47 29 3 116 2 RR5 Two-component response regulator ORR5 Oryza sativa subsp. japonica
Q4GZK6 5.25e-06 47 29 3 116 2 RR5 Two-component response regulator ORR5 Oryza sativa subsp. indica
P0A4H2 5.46e-06 48 30 2 113 1 bvgA Virulence factors putative positive transcription regulator BvgA Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
P0A4H4 5.46e-06 48 30 2 113 3 bvgA Virulence factors putative positive transcription regulator BvgA Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
P0A4H3 5.46e-06 48 30 2 113 3 bvgA Virulence factors putative positive transcription regulator BvgA Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
P06628 5.57e-06 47 27 1 120 1 spo0F Sporulation initiation phosphotransferase F Bacillus subtilis (strain 168)
Q6K8X6 5.61e-06 50 29 1 109 2 RR23 Two-component response regulator ORR23 Oryza sativa subsp. japonica
B8AEH1 5.61e-06 50 29 1 109 3 RR23 Two-component response regulator ORR23 Oryza sativa subsp. indica
P43015 5.76e-06 50 32 1 80 2 hilA Transcriptional regulator HilA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q5PEB1 5.87e-06 50 32 1 80 3 hilA Transcriptional regulator HilA Salmonella paratyphi A (strain ATCC 9150 / SARB42)
O74539 6.24e-06 50 31 2 116 1 mak3 Peroxide stress-activated histidine kinase mak3 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q9AAK0 6.64e-06 49 32 3 108 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q9FXD6 6.74e-06 49 29 3 112 1 ARR11 Two-component response regulator ARR11 Arabidopsis thaliana
Q86CZ2 6.9e-06 50 27 3 122 1 dhkK Hybrid signal transduction histidine kinase K Dictyostelium discoideum
Q0D3B6 7.53e-06 49 29 3 112 2 PRR37 Two-component response regulator-like PRR37 Oryza sativa subsp. japonica
A2YQ93 7.53e-06 49 29 3 112 2 PRR37 Two-component response regulator-like PRR37 Oryza sativa subsp. indica
P48027 7.61e-06 49 25 1 112 3 gacS Sensor protein GacS Pseudomonas syringae pv. syringae
Q1D359 1e-05 48 32 0 76 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Myxococcus xanthus (strain DK1622)
P10046 1.01e-05 49 28 3 114 3 dctD C4-dicarboxylate transport transcriptional regulatory protein DctD Rhizobium leguminosarum
P24908 1.02e-05 48 31 2 107 1 PA0034 Putative transcriptional regulator Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q689G6 1.04e-05 49 24 7 229 2 PRR95 Two-component response regulator-like PRR95 Oryza sativa subsp. japonica
G0SB31 1.17e-05 49 31 2 105 1 SKN7 Transcription factor SKN7 Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)
O82798 1.17e-05 48 40 3 75 1 ARR4 Two-component response regulator ARR4 Arabidopsis thaliana
P43016 1.17e-05 48 32 1 80 3 hilA Transcriptional regulator HilA Salmonella typhi
Q9ZWS9 1.26e-05 48 37 1 64 1 ARR3 Two-component response regulator ARR3 Arabidopsis thaliana
Q940D0 1.3e-05 48 26 2 111 1 ARR1 Two-component response regulator ARR1 Arabidopsis thaliana
Q8EQQ3 1.6e-05 48 32 3 101 3 lytT Sensory transduction protein LytT Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q3ADA6 1.62e-05 48 26 2 105 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
Q87GU5 1.7e-05 48 30 1 103 3 luxQ Autoinducer 2 sensor kinase/phosphatase LuxQ Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q67W50 1.73e-05 48 27 1 109 3 RR25 Two-component response regulator ORR25 Oryza sativa subsp. japonica
Q7MD16 1.76e-05 48 31 2 109 3 luxQ Autoinducer 2 sensor kinase/phosphatase LuxQ Vibrio vulnificus (strain YJ016)
Q8D5Z6 1.76e-05 48 31 2 109 3 luxQ Autoinducer 2 sensor kinase/phosphatase LuxQ Vibrio vulnificus (strain CMCP6)
P62640 1.78e-05 48 26 3 130 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
O14002 1.81e-05 48 30 3 128 3 mak2 Peroxide stress-activated histidine kinase mak2 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
O80366 1.84e-05 47 30 2 78 1 ARR9 Two-component response regulator ARR9 Arabidopsis thaliana
Q67P67 1.87e-05 48 27 2 105 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
Q9ZWS6 1.89e-05 47 34 2 72 1 ARR6 Two-component response regulator ARR6 Arabidopsis thaliana
P52931 1.97e-05 47 31 2 90 3 spo0A Stage 0 sporulation protein A (Fragment) Niallia circulans
P23890 1.99e-05 48 30 3 101 1 cadC Transcriptional activator CadC Escherichia coli (strain K12)
Q9F8D7 2.37e-05 48 25 1 112 3 gacS Sensor histidine kinase GacS Pseudomonas protegens (strain DSM 19095 / LMG 27888 / CFBP 6595 / CHA0)
Q39T95 2.37e-05 47 27 4 143 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
P96602 2.48e-05 47 28 2 125 3 dctR Probable C4-dicarboxylate response regulator DctR Bacillus subtilis (strain 168)
P13632 2.55e-05 48 28 3 113 1 dctD C4-dicarboxylate transport transcriptional regulatory protein DctD Rhizobium meliloti (strain 1021)
Q4A010 2.85e-05 47 34 3 99 3 lytR Sensory transduction protein LytR Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q9ZWJ9 2.85e-05 48 36 0 60 1 ARR2 Two-component response regulator ARR2 Arabidopsis thaliana
Q9FGT7 3.36e-05 47 31 2 109 2 ARR18 Two-component response regulator ARR18 Arabidopsis thaliana
P09432 3.43e-05 47 26 2 130 3 ntrC DNA-binding transcriptional regulator NtrC Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
Q3LWR6 3.94e-05 46 29 3 99 3 todT Response regulator protein TodT Pseudomonas putida
I7CA98 3.94e-05 46 29 3 99 1 todT Response regulator protein TodT Pseudomonas putida (strain DOT-T1E)
A5W4E2 3.94e-05 46 29 3 99 1 todT Response regulator protein TodT Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q5SML4 4e-05 47 28 3 120 2 HK2 Probable histidine kinase 2 Oryza sativa subsp. japonica
A2YA15 4e-05 47 28 3 120 3 HK2 Probable histidine kinase 2 Oryza sativa subsp. indica
Q9SB04 4.29e-05 46 30 2 80 1 ARR5 Two-component response regulator ARR5 Arabidopsis thaliana
P28787 4.41e-05 47 25 6 204 3 ntrC DNA-binding transcriptional regulator NtrC Proteus hauseri
O80365 4.61e-05 46 31 1 69 1 ARR8 Two-component response regulator ARR8 Arabidopsis thaliana
Q5N6V8 4.7e-05 47 28 3 112 3 RR26 Two-component response regulator ORR26 Oryza sativa subsp. japonica
F4JZT3 5.16e-05 45 29 3 109 2 ARR24 Two-component response regulator 24 Arabidopsis thaliana
Q9ZTP3 5.75e-05 47 30 4 122 1 EIN4 Protein EIN4 Arabidopsis thaliana
P24072 6.13e-05 44 25 2 117 1 cheY Chemotaxis protein CheY Bacillus subtilis (strain 168)
Q55169 6.24e-05 45 30 4 123 1 rcp1 Response regulator Rcp1 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q04848 7.02e-05 46 24 1 115 3 ntrC DNA-binding transcriptional regulator NtrC Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
P45709 7.18e-05 44 29 6 119 3 ccdB Protein CcdB Bacillus subtilis (strain 168)
P0A4I4 7.23e-05 46 25 2 118 3 spo0A Stage 0 sporulation protein A Bacillus thuringiensis
P0A4I3 7.23e-05 46 25 2 118 3 spo0A Stage 0 sporulation protein A Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q1IQS9 8.68e-05 46 30 2 111 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Koribacter versatilis (strain Ellin345)
Q8EQW0 8.7e-05 46 26 2 94 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q942A1 9.05e-05 45 32 2 77 2 RR4 Two-component response regulator ORR4 Oryza sativa subsp. japonica
Q4GZK7 9.05e-05 45 32 2 77 2 RR4 Two-component response regulator ORR4 Oryza sativa subsp. indica
P58253 0.000104 45 33 4 93 3 spo0A Stage 0 sporulation protein A homolog Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
P30198 0.000108 45 24 4 150 4 epiQ Putative epidermin response regulator Staphylococcus epidermidis
Q10N34 0.000116 46 26 3 115 2 PRR73 Two-component response regulator-like PRR73 Oryza sativa subsp. japonica
A2XFB7 0.000116 46 26 3 115 2 PRR73 Two-component response regulator-like PRR73 Oryza sativa subsp. indica
P62637 0.000116 45 34 3 95 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
O32197 0.00012 45 26 4 167 2 liaR Transcriptional regulatory protein LiaR Bacillus subtilis (strain 168)
Q9KLK7 0.000121 46 29 1 103 1 luxQ Autoinducer 2 sensor kinase/phosphatase LuxQ Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q9KM66 0.000125 46 27 1 114 1 cqsS CAI-1 autoinducer sensor kinase/phosphatase CqsS Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P42012 0.000126 45 28 1 89 3 spo0A Stage 0 sporulation protein A Lysinibacillus sphaericus
Q9HWA4 0.000128 45 23 4 138 1 pprB Two-component response regulator PprB Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P39048 0.000142 45 28 1 109 2 patA Protein PatA Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q9KU36 0.000146 45 29 2 121 3 VC_0693 Uncharacterized response regulatory protein VC_0693 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q2QXY3 0.000149 44 33 3 65 2 RR10 Two-component response regulator ORR10 Oryza sativa subsp. japonica
B8BLZ4 0.000149 44 33 3 65 2 RR10 Two-component response regulator ORR10 Oryza sativa subsp. indica

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS04490
Feature type CDS
Gene hprR
Product response regulator transcription factor HprR
Location 950185 - 950856 (strand: 1)
Length 672 (nucleotides) / 223 (amino acids)

Contig

Accession term accessions NZ_VXKB01000001 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_241
Orthogroup size 8
N. genomes 6

Actions

Genomic region

Domains

PF00072 Response regulator receiver domain
PF00486 Transcriptional regulatory protein, C terminal

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0745 Signal transduction mechanisms (T)
Transcription (K)
TK DNA-binding response regulator, OmpR family, contains REC and winged-helix (wHTH) domain

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K07665 two-component system, OmpR family, copper resistance phosphate regulon response regulator CusR Two-component system Imipenem resistance, repression of porin OprD

Protein Sequence

MKILLIEDHEKTGSWVKKGLEETGFIVDITTDGRDGLYLALENDYRLIILDIMLPGMDGWEVLKTLRTSKMVPVICLTARDAVADRVKGLELGANDYLVKPFSFSELLARVKNQLRVHQSVSAVIDIADLKIDLTRHEVQRGGIKITLTRQEYSLLLFFALHAGDILPRTLIAGEVWGIDFESDTNIVDVAIRRLRKKIDSDYDTKLIETVRGMGYRLNRPET

Flanking regions ( +/- flanking 50bp)

AAAATAAACTGACAGACAGATACCATAAGTACAATTTTCGGGTAGCAAAAATGAAAATATTACTGATTGAAGATCATGAGAAAACCGGTAGCTGGGTTAAAAAAGGACTGGAAGAAACCGGGTTTATTGTTGATATCACCACAGACGGCAGGGATGGTCTTTATCTCGCGCTTGAAAATGACTACCGGCTGATTATTTTAGATATTATGCTGCCGGGGATGGATGGCTGGGAAGTCCTGAAAACACTGCGTACATCCAAAATGGTACCGGTTATTTGCCTGACCGCCCGGGACGCGGTAGCGGACAGAGTGAAAGGGCTGGAGCTGGGTGCTAATGATTATTTAGTTAAGCCATTTTCATTTTCTGAGCTGCTGGCAAGAGTAAAAAATCAATTACGTGTCCATCAATCTGTATCGGCAGTAATTGATATTGCTGATCTGAAGATTGACCTTACCCGTCATGAAGTACAGCGGGGCGGAATAAAAATAACACTGACACGCCAGGAATATTCATTGTTGCTCTTTTTTGCTCTGCATGCGGGCGATATTTTACCGAGAACCCTGATTGCCGGTGAAGTATGGGGAATTGATTTTGAAAGTGATACTAATATTGTCGATGTGGCTATACGGCGTCTGAGAAAAAAAATAGATAGTGACTATGATACCAAATTAATCGAAACTGTCCGCGGAATGGGATATCGTTTAAACAGGCCGGAAACATGAAAATACAGTCATTACGGTTTAAAATCATGTCATTATTTATCCTGCTGATG