Homologs in group_230

Help

7 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_02140 FBDBKF_02140 30.0 Morganella morganii S1 ompR DNA-binding response regulator, OmpR family, contains REC and winged-helix (wHTH) domain
EHELCC_02610 EHELCC_02610 30.0 Morganella morganii S2 ompR DNA-binding response regulator, OmpR family, contains REC and winged-helix (wHTH) domain
NLDBIP_00850 NLDBIP_00850 30.0 Morganella morganii S4 ompR DNA-binding response regulator, OmpR family, contains REC and winged-helix (wHTH) domain
LHKJJB_01185 LHKJJB_01185 30.0 Morganella morganii S3 ompR DNA-binding response regulator, OmpR family, contains REC and winged-helix (wHTH) domain
HKOGLL_01225 HKOGLL_01225 30.0 Morganella morganii S5 ompR DNA-binding response regulator, OmpR family, contains REC and winged-helix (wHTH) domain
F4V73_RS03915 F4V73_RS03915 31.8 Morganella psychrotolerans - copper/silver response regulator transcription factor
F4V73_RS04490 F4V73_RS04490 32.3 Morganella psychrotolerans hprR response regulator transcription factor HprR

Distribution of the homologs in the orthogroup group_230

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_230

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q8DPL7 1.13e-58 187 43 2 227 1 walR Transcriptional regulatory protein WalR Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
A0A0H2UQ68 1.13e-58 187 43 2 227 1 walR Transcriptional regulatory protein WalR Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
A0A0H2ZN37 1.13e-58 187 43 2 227 1 walR Transcriptional regulatory protein WalR Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
P13792 1.81e-57 185 41 1 232 1 phoP Alkaline phosphatase synthesis transcriptional regulatory protein PhoP Bacillus subtilis (strain 168)
P37478 3.36e-50 166 40 2 225 1 walR Transcriptional regulatory protein WalR Bacillus subtilis (strain 168)
Q4A160 3.78e-49 163 40 2 229 3 walR Transcriptional regulatory protein WalR Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q7A216 5.77e-49 163 40 3 233 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain MW2)
Q9RDT5 5.77e-49 163 40 3 233 1 walR Transcriptional regulatory protein WalR Staphylococcus aureus
A8YYU1 5.77e-49 163 40 3 233 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain USA300 / TCH1516)
Q6GD72 5.77e-49 163 40 3 233 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain MSSA476)
Q6GKS7 5.77e-49 163 40 3 233 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain MRSA252)
Q7A8E1 5.77e-49 163 40 3 233 1 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain N315)
Q99XF3 5.77e-49 163 40 3 233 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QD57 5.77e-49 163 40 3 233 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain Newman)
Q5HJX7 5.77e-49 163 40 3 233 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain COL)
Q2YUQ3 5.77e-49 163 40 3 233 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain bovine RF122 / ET3-1)
A5INQ9 5.77e-49 163 40 3 233 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain JH9)
Q2G2U6 5.77e-49 163 40 3 233 1 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FKN8 5.77e-49 163 40 3 233 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain USA300)
A6TXG8 5.77e-49 163 40 3 233 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain JH1)
A7WWQ5 5.77e-49 163 40 3 233 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q8CQK0 5.83e-49 163 40 3 233 3 walR Transcriptional regulatory protein WalR Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HK18 5.83e-49 163 40 3 233 3 walR Transcriptional regulatory protein WalR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q4LAJ9 6.29e-49 163 40 3 233 3 walR Transcriptional regulatory protein WalR Staphylococcus haemolyticus (strain JCSC1435)
O78428 2.58e-48 162 40 3 230 3 ycf27 Probable transcriptional regulator ycf27 Guillardia theta
P32040 1.17e-46 157 37 3 232 3 SYNPCC7002_A0851 Probable transcriptional regulatory protein SYNPCC7002_A0851 Picosynechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)
P48259 1.56e-46 157 37 4 231 3 ycf27 Probable transcriptional regulator ycf27 Cyanophora paradoxa
P28257 2.63e-46 157 38 4 231 3 ycf27 Probable transcriptional regulator ycf27 Galdieria sulphuraria
P39663 4.1e-46 156 34 2 232 1 sphR Alkaline phosphatase synthesis transcriptional regulatory protein SphR Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
P28835 5.27e-46 155 37 4 230 3 ycf27 Probable transcriptional regulator ycf27 Porphyridium aerugineum
P9WGL9 5.5e-46 155 33 1 225 1 regX3 Sensory transduction protein RegX3 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGL8 5.5e-46 155 33 1 225 2 regX3 Sensory transduction protein RegX3 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
O07130 5.5e-46 155 33 1 225 1 regX3 Sensory transduction protein RegX3 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P51358 2.93e-45 154 36 4 230 3 ycf27 Probable transcriptional regulator ycf27 Porphyra purpurea
Q742C1 3.09e-45 153 35 2 227 3 mprA Response regulator MprA Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
A0QBQ9 3.09e-45 153 35 2 227 3 mprA Response regulator MprA Mycobacterium avium (strain 104)
Q1XDC9 3.12e-45 154 36 4 230 3 ycf27 Probable transcriptional regulator ycf27 Neopyropia yezoensis
A1KHB7 9.53e-45 152 35 2 227 3 mprA Response regulator MprA Mycobacterium bovis (strain BCG / Pasteur 1173P2)
Q7U0X4 9.53e-45 152 35 2 227 1 mprA Response regulator MprA Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q9TLQ4 1.05e-44 152 39 6 232 3 ycf27 Probable transcriptional regulator ycf27 Cyanidium caldarium
P9WGM9 1.42e-44 151 35 2 227 1 mprA Response regulator MprA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM8 1.42e-44 151 35 2 227 3 mprA Response regulator MprA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5U123 1.42e-44 151 35 2 227 3 mprA Response regulator MprA Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
Q9CD68 5.01e-44 150 35 2 227 3 mprA Response regulator MprA Mycobacterium leprae (strain TN)
A0R3I8 5.08e-44 150 35 2 227 1 mprA Response regulator MprA Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
A1TEL7 1.47e-43 149 33 1 227 3 mprA Response regulator MprA Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
Q9F868 1.61e-43 149 33 2 226 1 regX3 Sensory transduction protein RegX3 Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
A0PWB4 2.65e-43 148 34 2 228 3 mprA Response regulator MprA Mycobacterium ulcerans (strain Agy99)
Q1B3X8 7e-43 147 35 3 228 3 mprA Response regulator MprA Mycobacterium sp. (strain MCS)
A1UL70 7e-43 147 35 3 228 3 mprA Response regulator MprA Mycobacterium sp. (strain KMS)
A3Q5L9 7e-43 147 35 3 228 3 mprA Response regulator MprA Mycobacterium sp. (strain JLS)
Q04942 4.15e-42 145 34 2 223 1 afsQ1 Transcriptional regulatory protein AfsQ1 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
A0A4P7TS68 1.37e-41 144 32 1 227 1 ompR DNA-binding dual transcriptional regulator OmpR Shigella flexneri serotype 5a (strain M90T)
P0AA21 1.37e-41 144 32 1 227 3 ompR DNA-binding dual transcriptional regulator OmpR Shigella flexneri
P0AA19 1.37e-41 144 32 1 227 3 ompR DNA-binding dual transcriptional regulator OmpR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
A0A0H3NGY1 1.37e-41 144 32 1 227 3 ompR DNA-binding dual transcriptional regulator OmpR Salmonella typhimurium (strain SL1344)
P0AA20 1.37e-41 144 32 1 227 1 ompR DNA-binding dual transcriptional regulator OmpR Salmonella typhi
P0AA16 1.37e-41 144 32 1 227 1 ompR DNA-binding dual transcriptional regulator OmpR Escherichia coli (strain K12)
P0AA17 1.37e-41 144 32 1 227 3 ompR DNA-binding dual transcriptional regulator OmpR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AA18 1.37e-41 144 32 1 227 3 ompR DNA-binding dual transcriptional regulator OmpR Escherichia coli O157:H7
A0QTK2 5.22e-41 142 34 4 224 1 mtrA DNA-binding response regulator MtrA Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q93CB8 1.02e-40 141 34 4 224 3 mtrA DNA-binding response regulator MtrA Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
P9WGM7 1.09e-40 141 34 4 224 1 mtrA DNA-binding response regulator MtrA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM6 1.09e-40 141 34 4 224 3 mtrA DNA-binding response regulator MtrA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0A5Z5 1.09e-40 141 34 4 224 3 mtrA DNA-binding response regulator MtrA Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
O34903 1.15e-40 141 35 2 221 3 ykoG Uncharacterized transcriptional regulatory protein YkoG Bacillus subtilis (strain 168)
L7N689 2.26e-40 142 34 2 223 1 trcR Transcriptional regulatory protein TrcR Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Q31S42 6.36e-40 140 35 3 226 1 rpaA DNA-binding dual master transcriptional regulator RpaA Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q9CCJ2 1.41e-39 139 34 4 224 3 mtrA DNA-binding response regulator MtrA Mycobacterium leprae (strain TN)
P54884 1.98e-39 137 34 1 196 3 rgx3 Sensory transduction protein RegX3 Mycobacterium leprae (strain TN)
P35163 9.43e-39 137 35 5 231 1 resD Transcriptional regulatory protein ResD Bacillus subtilis (strain 168)
P21866 3.89e-38 135 33 2 224 1 kdpE KDP operon transcriptional regulatory protein KdpE Escherichia coli (strain K12)
Q44006 4.88e-38 134 34 3 223 2 czcR Transcriptional activator protein CzcR Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q9AE24 6.61e-38 134 31 2 224 3 rprY Transcriptional regulatory protein RprY Bacteroides fragilis (strain YCH46)
Q7D9K0 1.48e-37 134 33 2 227 3 tcrA Transcriptional regulatory protein TcrA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
O07776 1.48e-37 134 33 2 227 1 tcrA Transcriptional regulatory protein TcrA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Q55890 1.88e-37 134 34 3 226 1 rpaA DNA-binding dual master transcriptional regulator RpaA Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q7A1J1 2.14e-37 133 29 2 224 3 saeR Response regulator SaeR Staphylococcus aureus (strain MW2)
Q6GBC4 2.14e-37 133 29 2 224 3 saeR Response regulator SaeR Staphylococcus aureus (strain MSSA476)
Q6GIT6 2.14e-37 133 29 2 224 3 saeR Response regulator SaeR Staphylococcus aureus (strain MRSA252)
Q7A6V3 2.14e-37 133 29 2 224 1 saeR Response regulator SaeR Staphylococcus aureus (strain N315)
Q99VR7 2.14e-37 133 29 2 224 3 saeR Response regulator SaeR Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q840P8 2.14e-37 133 29 2 224 1 saeR Response regulator SaeR Staphylococcus aureus (strain Newman)
Q5HHW4 2.14e-37 133 29 2 224 1 saeR Response regulator SaeR Staphylococcus aureus (strain COL)
Q2YSM5 2.14e-37 133 29 2 224 3 saeR Response regulator SaeR Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q2G2G2 2.14e-37 133 29 2 224 1 saeR Response regulator SaeR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FIT4 2.14e-37 133 29 2 224 3 saeR Response regulator SaeR Staphylococcus aureus (strain USA300)
P94504 2.16e-37 133 31 2 224 3 yvrH Transcriptional regulatory protein YvrH Bacillus subtilis (strain 168)
Q50136 2.11e-36 130 36 4 202 3 prrA Transcriptional regulatory protein PrrA Mycobacterium leprae (strain TN)
P9WGM1 2.32e-36 130 36 4 202 1 prrA Transcriptional regulatory protein PrrA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM0 2.32e-36 130 36 4 202 3 prrA Transcriptional regulatory protein PrrA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0A5Z7 2.32e-36 130 36 4 202 3 prrA Transcriptional regulatory protein PrrA Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P69228 2.78e-36 130 33 4 228 1 baeR Transcriptional regulatory protein BaeR Escherichia coli (strain K12)
P69229 2.78e-36 130 33 4 228 1 baeR Transcriptional regulatory protein BaeR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q82EB1 3.31e-36 130 32 5 235 3 cseB Transcriptional regulatory protein CseB Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q9ZEP4 3.4e-36 130 32 4 234 1 cseB Transcriptional regulatory protein CseB Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
P54443 7.82e-36 129 36 6 228 3 yrkP Uncharacterized transcriptional regulatory protein YrkP Bacillus subtilis (strain 168)
P45607 1.28e-35 129 32 4 229 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Shigella flexneri
P45606 1.89e-35 128 32 4 229 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Shigella dysenteriae
P0AFJ5 1.95e-35 128 32 4 229 1 phoB Phosphate regulon transcriptional regulatory protein PhoB Escherichia coli (strain K12)
P0AFJ6 1.95e-35 128 32 4 229 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Escherichia coli O157:H7
Q44929 2.17e-35 128 35 5 231 3 gtcR Response regulator GtcR Aneurinibacillus migulanus
P42421 2.47e-35 128 32 3 224 3 yxdJ Transcriptional regulatory protein YxdJ Bacillus subtilis (strain 168)
P23620 3.83e-35 127 34 4 226 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
G3XCY6 4.26e-35 127 34 4 226 1 gltR Transcriptional regulatory protein GltR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P94413 4.91e-35 127 32 5 234 3 yclJ Uncharacterized transcriptional regulatory protein YclJ Bacillus subtilis (strain 168)
Q02540 5.29e-35 127 33 4 227 1 copR Transcriptional activator protein CopR Pseudomonas syringae pv. tomato
Q99U73 8.51e-35 126 35 4 222 3 arlR Response regulator ArlR Staphylococcus aureus (strain N315)
P44918 9e-35 126 32 5 229 3 arcA Aerobic respiration control protein ArcA homolog Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P44895 1.29e-34 126 38 3 223 3 cpxR Transcriptional regulatory protein CpxR homolog Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q8DN02 2.58e-34 125 34 4 225 1 rr06 Response regulator RR06 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
A0A0H2ZNF6 2.58e-34 125 34 4 225 1 rr06 Response regulator RR06 Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
P42244 2.87e-34 125 30 2 226 3 ycbL Uncharacterized transcriptional regulatory protein YcbL Bacillus subtilis (strain 168)
Q47456 3.51e-34 125 33 2 222 3 pcoR Transcriptional regulatory protein PcoR Escherichia coli
P0C001 5.45e-34 124 34 4 222 3 arlR Response regulator ArlR Staphylococcus aureus (strain MW2)
Q6G9E6 5.45e-34 124 34 4 222 3 arlR Response regulator ArlR Staphylococcus aureus (strain MSSA476)
Q6GGZ3 5.45e-34 124 34 4 222 3 arlR Response regulator ArlR Staphylococcus aureus (strain MRSA252)
P0C000 5.45e-34 124 34 4 222 3 arlR Response regulator ArlR Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HG04 5.45e-34 124 34 4 222 3 arlR Response regulator ArlR Staphylococcus aureus (strain COL)
Q2YY03 5.45e-34 124 34 4 222 3 arlR Response regulator ArlR Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q9KJN4 5.45e-34 124 34 4 222 1 arlR Response regulator ArlR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FH23 5.45e-34 124 34 4 222 3 arlR Response regulator ArlR Staphylococcus aureus (strain USA300)
Q8CQ17 8.56e-34 124 30 1 224 1 saeR Response regulator SaeR Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HR28 8.56e-34 124 30 1 224 3 saeR Response regulator SaeR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
O06978 1e-33 124 32 4 230 3 yvcP Uncharacterized transcriptional regulatory protein YvcP Bacillus subtilis (strain 168)
Q52990 2.37e-33 122 32 3 224 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Rhizobium meliloti (strain 1021)
P0DMK7 5.51e-33 122 32 6 227 3 irlR Transcriptional activator protein IrlR Burkholderia pseudomallei (strain K96243)
I1WSZ4 5.51e-33 122 32 6 227 3 irlR Transcriptional activator protein IrlR Burkholderia pseudomallei (strain 1026b)
P0A4H8 5.82e-33 121 30 3 223 3 ciaR Transcriptional regulatory protein CiaR Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P0A4H7 5.82e-33 121 30 3 223 3 ciaR Transcriptional regulatory protein CiaR Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
A0A0H3GGB5 6.89e-33 121 36 4 228 2 cpxR Transcriptional regulatory protein CpxR Klebsiella pneumoniae subsp. pneumoniae (strain HS11286)
P45605 1.86e-32 120 31 4 229 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Klebsiella pneumoniae
P0ACZ8 2.12e-32 120 31 2 223 1 cusR Transcriptional regulatory protein CusR Escherichia coli (strain K12)
P0ACZ9 2.12e-32 120 31 2 223 3 cusR Transcriptional regulatory protein CusR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AD00 2.12e-32 120 31 2 223 3 cusR Transcriptional regulatory protein CusR Escherichia coli O157:H7
P0A9Q4 2.56e-32 120 30 3 229 3 arcA Aerobic respiration control protein ArcA Shigella flexneri
P0A9Q1 2.56e-32 120 30 3 229 1 arcA Aerobic respiration control protein ArcA Escherichia coli (strain K12)
P0A9Q2 2.56e-32 120 30 3 229 3 arcA Aerobic respiration control protein ArcA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0A9Q3 2.56e-32 120 30 3 229 3 arcA Aerobic respiration control protein ArcA Escherichia coli O157:H7
P0AE90 2.95e-32 120 36 4 226 3 cpxR Transcriptional regulatory protein CpxR Shigella flexneri
P0AE88 2.95e-32 120 36 4 226 1 cpxR Transcriptional regulatory protein CpxR Escherichia coli (strain K12)
P0AE89 2.95e-32 120 36 4 226 3 cpxR Transcriptional regulatory protein CpxR Escherichia coli O157:H7
Q4L6C6 4.08e-32 119 30 4 226 3 arlR Response regulator ArlR Staphylococcus haemolyticus (strain JCSC1435)
O32192 4.18e-32 119 30 3 223 1 cssR Transcriptional regulatory protein CssR Bacillus subtilis (strain 168)
Q9HUI2 6.38e-32 119 32 7 234 3 aruR Transcriptional regulatory protein AruR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P08368 7.08e-32 119 31 4 224 1 creB Transcriptional regulatory protein CreB Escherichia coli (strain K12)
Q7A0U4 2.25e-31 118 32 4 230 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain MW2)
Q9L524 2.25e-31 118 32 4 230 2 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus
Q6G972 2.25e-31 118 32 4 230 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain MSSA476)
Q6GGK6 2.25e-31 118 32 4 230 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain MRSA252)
Q7A5H6 2.25e-31 118 32 4 230 1 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain N315)
Q7A2R6 2.25e-31 118 32 4 230 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HFT0 2.25e-31 118 32 4 230 2 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain COL)
Q2FY79 2.25e-31 118 32 4 230 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q49XM7 6.39e-31 116 33 4 222 3 arlR Response regulator ArlR Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q9ZHD3 1.04e-30 115 32 4 225 3 silR Probable transcriptional regulatory protein SilR Salmonella typhimurium
P0A4I0 1.13e-30 115 31 3 230 3 dltR Transcriptional regulatory protein DltR Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
P0A4H9 1.13e-30 115 31 3 230 3 dltR Transcriptional regulatory protein DltR Streptococcus agalactiae serotype III (strain NEM316)
P45189 1.62e-30 115 34 4 226 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q06239 2.07e-30 115 33 5 231 3 vanR Regulatory protein VanR Enterococcus faecium
P9WGN1 2.3e-30 115 32 5 228 1 kdpE Transcriptional regulatory protein KdpE Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGN0 2.3e-30 115 32 5 228 3 kdpE Transcriptional regulatory protein KdpE Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P50351 4.82e-30 114 31 3 238 3 chvI Transcriptional regulatory protein ChvI Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q9HV32 5.47e-30 114 30 3 223 1 pmrA Response regulator protein PmrA Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q47744 6.07e-30 114 28 3 227 3 vanRB Regulatory protein VanRB Enterococcus faecalis (strain ATCC 700802 / V583)
P76340 7.91e-30 113 29 3 225 1 hprR Transcriptional regulatory protein HprR Escherichia coli (strain K12)
Q5HLN2 1.31e-29 113 29 3 221 3 hssR Heme response regulator HssR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q4L481 1.41e-29 113 31 2 203 3 graR Response regulator protein GraR Staphylococcus haemolyticus (strain JCSC1435)
P50350 1.57e-29 113 31 3 237 3 chvI Transcriptional regulatory protein ChvI Rhizobium meliloti (strain 1021)
O69730 1.85e-29 112 31 2 223 1 tcrX Probable transcriptional regulatory protein TcrX Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Q8CP82 1.87e-29 112 34 5 224 3 arlR Response regulator ArlR Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q8CN92 3.01e-29 112 29 3 221 3 hssR Heme response regulator HssR Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
A6WZ81 4.13e-29 112 31 1 227 3 ctrA Cell cycle response regulator CtrA Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
Q07597 6.15e-29 111 32 5 230 3 nisR Nisin biosynthesis regulatory protein NisR Lactococcus lactis subsp. lactis
Q8FZ93 6.74e-29 111 31 1 227 1 ctrA Cell cycle response regulator CtrA Brucella suis biovar 1 (strain 1330)
B0CI76 6.74e-29 111 31 1 227 3 ctrA Cell cycle response regulator CtrA Brucella suis (strain ATCC 23445 / NCTC 10510)
A5VRW9 6.74e-29 111 31 1 227 1 ctrA Cell cycle response regulator CtrA Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q7CNV1 6.74e-29 111 31 1 227 1 ctrA Cell cycle response regulator CtrA Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
A9M708 6.74e-29 111 31 1 227 3 ctrA Cell cycle response regulator CtrA Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q9ZHS1 6.74e-29 111 31 1 227 1 ctrA Cell cycle response regulator CtrA Brucella abortus biovar 1 (strain 9-941)
Q2YQA4 6.74e-29 111 31 1 227 1 ctrA Cell cycle response regulator CtrA Brucella abortus (strain 2308)
B2S753 6.74e-29 111 31 1 227 3 ctrA Cell cycle response regulator CtrA Brucella abortus (strain S19)
Q5HPC3 7.8e-29 110 34 5 224 3 arlR Response regulator ArlR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q6GE73 1e-28 110 27 3 226 3 hssR Heme response regulator HssR Staphylococcus aureus (strain MRSA252)
Q2YZ24 1.04e-28 110 27 3 226 3 hssR Heme response regulator HssR Staphylococcus aureus (strain bovine RF122 / ET3-1)
P31079 1.48e-28 110 30 3 226 3 petR Protein PetR Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
Q7A039 2.02e-28 110 27 3 226 3 hssR Heme response regulator HssR Staphylococcus aureus (strain MW2)
A8Z552 2.02e-28 110 27 3 226 3 hssR Heme response regulator HssR Staphylococcus aureus (strain USA300 / TCH1516)
Q6G6V9 2.02e-28 110 27 3 226 3 hssR Heme response regulator HssR Staphylococcus aureus (strain MSSA476)
Q7A3X1 2.02e-28 110 27 3 226 3 hssR Heme response regulator HssR Staphylococcus aureus (strain N315)
Q99RR6 2.02e-28 110 27 3 226 3 hssR Heme response regulator HssR Staphylococcus aureus (strain Mu50 / ATCC 700699)
A5IVE2 2.02e-28 110 27 3 226 3 hssR Heme response regulator HssR Staphylococcus aureus (strain JH9)
Q2FVQ9 2.02e-28 110 27 3 226 3 hssR Heme response regulator HssR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FED5 2.02e-28 110 27 3 226 3 hssR Heme response regulator HssR Staphylococcus aureus (strain USA300)
A6U488 2.02e-28 110 27 3 226 3 hssR Heme response regulator HssR Staphylococcus aureus (strain JH1)
A7X5Y5 2.02e-28 110 27 3 226 3 hssR Heme response regulator HssR Staphylococcus aureus (strain Mu3 / ATCC 700698)
P45337 2.2e-28 109 30 2 223 3 qseB Transcriptional regulatory protein QseB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q49ZT8 2.55e-28 109 30 3 221 3 hssR Heme response regulator HssR Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
P52076 4.61e-28 108 27 2 227 2 qseB Transcriptional regulatory protein QseB Escherichia coli (strain K12)
P66795 5.53e-28 108 27 2 223 3 qseB Transcriptional regulatory protein QseB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P66796 5.53e-28 108 27 2 223 3 qseB Transcriptional regulatory protein QseB Salmonella typhi
A8Z181 5.6e-28 108 30 2 203 3 graR Response regulator protein GraR Staphylococcus aureus (strain USA300 / TCH1516)
A6QEW8 5.6e-28 108 30 2 203 3 graR Response regulator protein GraR Staphylococcus aureus (strain Newman)
Q5HI09 5.6e-28 108 30 2 203 1 graR Response regulator protein GraR Staphylococcus aureus (strain COL)
Q2G0E0 5.6e-28 108 30 2 203 1 graR Response regulator protein GraR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FIY0 5.6e-28 108 30 2 203 3 graR Response regulator protein GraR Staphylococcus aureus (strain USA300)
Q07783 6.3e-28 109 31 5 239 3 chvI Transcriptional regulatory protein ChvI Rhizobium radiobacter
Q4L8L9 8.29e-28 108 29 4 224 3 hssR Heme response regulator HssR Staphylococcus haemolyticus (strain JCSC1435)
Q8CQ37 8.38e-28 108 30 2 203 3 graR Response regulator protein GraR Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HR81 8.38e-28 108 30 2 203 3 graR Response regulator protein GraR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q01473 8.83e-28 114 31 1 223 3 rcaC Protein RcaC Microchaete diplosiphon
Q01473 1.18e-10 63 31 3 125 3 rcaC Protein RcaC Microchaete diplosiphon
A6QJK3 9.93e-28 108 27 3 226 1 hssR Heme response regulator HssR Staphylococcus aureus (strain Newman)
Q5HDJ4 9.93e-28 108 27 3 226 3 hssR Heme response regulator HssR Staphylococcus aureus (strain COL)
Q6GJ11 1.1e-27 108 30 2 203 3 graR Response regulator protein GraR Staphylococcus aureus (strain MRSA252)
Q932F1 1.64e-27 107 30 2 203 1 graR Response regulator protein GraR Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q9K621 2.05e-27 107 31 4 212 3 bceR Sensory transduction protein BceR Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
P36556 2.71e-27 107 30 2 223 1 basR Transcriptional regulatory protein BasR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q2FWH6 3.17e-27 107 32 3 224 1 kdpE Transcriptional regulatory protein KdpE Staphylococcus aureus (strain NCTC 8325 / PS 47)
P30843 3.32e-27 106 29 2 223 1 basR Transcriptional regulatory protein BasR Escherichia coli (strain K12)
Q8XBS3 3.33e-27 106 27 2 227 2 qseB Transcriptional regulatory protein QseB Escherichia coli O157:H7
Q7A1L2 4.88e-27 106 30 2 203 3 graR Response regulator protein GraR Staphylococcus aureus (strain MW2)
Q6GBH1 4.88e-27 106 30 2 203 3 graR Response regulator protein GraR Staphylococcus aureus (strain MSSA476)
Q99VW2 4.88e-27 106 30 2 203 3 graR Response regulator protein GraR Staphylococcus aureus (strain N315)
A5IQL2 4.88e-27 106 30 2 203 3 graR Response regulator protein GraR Staphylococcus aureus (strain JH9)
A6TZD6 4.88e-27 106 30 2 203 3 graR Response regulator protein GraR Staphylococcus aureus (strain JH1)
A7WZC3 4.88e-27 106 30 2 203 3 graR Response regulator protein GraR Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q49VK3 6.5e-27 105 30 2 203 3 graR Response regulator protein GraR Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q2YSS2 1.06e-26 105 29 2 203 3 graR Response regulator protein GraR Staphylococcus aureus (strain bovine RF122 / ET3-1)
P0CL17 7.92e-26 103 29 3 223 2 tctD Transcriptional regulatory protein TctD Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
E1WA34 7.92e-26 103 29 3 223 3 tctD Transcriptional regulatory protein TctD Salmonella typhimurium (strain SL1344)
P0DM78 9.78e-26 102 32 5 229 1 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
F5ZP95 9.78e-26 102 32 5 229 1 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhimurium (strain ATCC 68169 / UK-1)
E1WFA1 9.78e-26 102 32 5 229 2 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhimurium (strain SL1344)
D0ZV90 9.78e-26 102 32 5 229 1 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhimurium (strain 14028s / SGSC 2262)
Q5PMJ1 9.78e-26 102 32 5 229 3 phoP Virulence transcriptional regulatory protein PhoP Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q8Z7H2 1.13e-25 102 31 4 227 3 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhi
Q9I4F9 2.03e-25 102 28 4 233 1 phoP Two-component response regulator PhoP Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9KM23 3.08e-25 102 30 6 231 1 vxrB Transcriptional regulatory protein VxrB Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q57QC3 6.03e-25 100 31 5 229 3 phoP Virulence transcriptional regulatory protein PhoP Salmonella choleraesuis (strain SC-B67)
P0A4I2 6.03e-25 100 28 3 225 3 cutR Transcriptional regulatory protein CutR Streptomyces lividans
P0A4I1 6.03e-25 100 28 3 225 3 cutR Transcriptional regulatory protein CutR Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q83RR0 1.37e-24 100 32 5 228 3 phoP Virulence transcriptional regulatory protein PhoP Shigella flexneri
Q8CXZ9 1.37e-24 100 32 5 228 3 phoP Transcriptional regulatory protein PhoP Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P23836 1.61e-24 99 32 5 228 1 phoP Transcriptional regulatory protein PhoP Escherichia coli (strain K12)
O34951 1.94e-24 99 28 2 207 3 bceR Sensory transduction protein BceR Bacillus subtilis (strain 168)
P13359 4.95e-24 99 28 5 227 3 virG Regulatory protein VirG Rhizobium rhizogenes
Q8X738 8.16e-24 97 30 2 226 3 phoP Transcriptional regulatory protein PhoP Escherichia coli O157:H7
P33112 2.31e-23 96 33 4 187 3 spaR Transcriptional regulatory protein SpaR Bacillus subtilis
Q55933 2.95e-23 96 27 6 238 1 rppA Response regulator RppA Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q9I0I1 9.99e-23 95 26 3 226 1 carR Response regulator protein CarR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q70FH0 1.09e-22 95 32 4 225 3 pmrA Transcriptional regulatory protein PmrA Pectobacterium parmentieri
B8H358 1.34e-22 95 27 1 223 3 ctrA Cell cycle transcriptional regulator CtrA Caulobacter vibrioides (strain NA1000 / CB15N)
P0CAW8 1.34e-22 95 27 1 223 3 ctrA Cell cycle transcriptional regulator CtrA Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
P58357 2.41e-22 94 27 6 226 3 torR TorCAD operon transcriptional regulatory protein TorR Escherichia coli O157:H7
P52108 2.47e-22 94 28 3 231 1 rstA Transcriptional regulatory protein RstA Escherichia coli (strain K12)
T2KMF4 6.64e-22 97 43 2 115 3 BN863_21930 Histidine kinase P4 Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1)
P38684 7.8e-22 92 26 4 225 1 torR TorCAD operon transcriptional regulatory protein TorR Escherichia coli (strain K12)
P07545 8.29e-22 93 29 5 227 3 virG Regulatory protein VirG Agrobacterium fabrum (strain C58 / ATCC 33970)
O31432 1.29e-21 92 28 5 223 3 ybdJ Uncharacterized transcriptional regulatory protein YbdJ Bacillus subtilis (strain 168)
O25918 3.15e-21 90 28 5 226 3 crdR Transcriptional regulatory protein CrdR Helicobacter pylori (strain ATCC 700392 / 26695)
Q04803 3.35e-19 87 27 4 228 3 pfeR Transcriptional activator protein PfeR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P62722 4.14e-19 86 28 5 227 3 virG Regulatory protein VirG Agrobacterium tumefaciens (strain 15955)
Q1XDE4 4.92e-19 85 28 5 197 3 ycf29 Probable transcriptional regulator ycf29 Neopyropia yezoensis
P46384 1.56e-18 81 37 1 115 1 pilG Protein PilG Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q44444 1.81e-18 84 28 5 227 3 virG Regulatory protein VirG Rhizobium radiobacter
O24973 1.91e-18 84 29 2 226 1 arsR Transcriptional regulatory protein ArsR Helicobacter pylori (strain ATCC 700392 / 26695)
P24072 2.8e-18 80 37 1 103 1 cheY Chemotaxis protein CheY Bacillus subtilis (strain 168)
Q05943 2.07e-17 81 30 3 165 3 glnR Transcriptional regulatory protein GlnR Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
P43501 1.36e-16 76 36 1 104 3 pilH Protein PilH Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q56312 1.77e-16 75 36 1 103 1 cheY Chemotaxis protein CheY Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q8GP20 1.88e-16 78 26 4 224 1 rssB Swarming motility regulation protein RssB Serratia marcescens
B8GZM2 2.36e-16 80 34 3 119 1 pleD Response regulator PleD Caulobacter vibrioides (strain NA1000 / CB15N)
Q9A5I5 2.36e-16 80 34 3 119 1 pleD Response regulator PleD Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q06065 3.45e-16 80 34 1 120 1 atoC Regulatory protein AtoC Escherichia coli (strain K12)
E0X9C7 9.46e-16 79 38 2 116 1 todS Sensor histidine kinase TodS Pseudomonas putida (strain DOT-T1E)
Q9KSB1 9.82e-16 78 43 1 92 1 VC_1348 Probable cyclic di-GMP phosphodiesterase VC_1348 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q8KIY1 1.49e-15 78 38 2 116 1 tmoS Sensor histidine kinase TmoS Pseudomonas mendocina
P06628 3.16e-15 72 37 2 113 1 spo0F Sporulation initiation phosphotransferase F Bacillus subtilis (strain 168)
Q10WZ6 3.46e-15 76 38 2 105 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Trichodesmium erythraeum (strain IMS101)
P51586 4.07e-15 72 34 2 122 3 None Uncharacterized 14.6 kDa protein in sodA1 3'region Leptolyngbya boryana
A5W4E3 4.61e-15 77 37 2 116 1 todS Sensor histidine kinase TodS Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q3LWR6 4.48e-14 72 30 2 155 3 todT Response regulator protein TodT Pseudomonas putida
I7CA98 4.48e-14 72 30 2 155 1 todT Response regulator protein TodT Pseudomonas putida (strain DOT-T1E)
A5W4E2 4.48e-14 72 30 2 155 1 todT Response regulator protein TodT Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
P96602 5.52e-14 71 31 4 176 3 dctR Probable C4-dicarboxylate response regulator DctR Bacillus subtilis (strain 168)
Q9HV27 6.54e-14 73 41 3 94 1 PA4781 Cyclic di-GMP phosphodiesterase PA4781 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P41789 8.33e-14 73 35 0 111 1 glnG DNA-binding transcriptional regulator NtrC Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A4H5 9.45e-14 68 31 1 118 3 cheY Chemotaxis protein CheY Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
P0A4H6 9.45e-14 68 31 1 118 3 cheY Chemotaxis protein CheY Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
P52942 1.14e-13 68 35 2 114 3 spo0F Sporulation initiation phosphotransferase F Bacillus thuringiensis subsp. kurstaki
A1SMR4 1.15e-13 72 33 2 112 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Nocardioides sp. (strain ATCC BAA-499 / JS614)
Q54YZ9 1.23e-13 73 33 2 124 3 dhkJ Hybrid signal transduction histidine kinase J Dictyostelium discoideum
P52934 1.95e-13 70 36 2 118 1 spo0A Stage 0 sporulation protein A Geobacillus stearothermophilus
Q9I4N3 2.66e-13 71 30 3 156 1 fleR Response regulator protein FleR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q1IRH0 4.81e-13 70 29 4 152 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Koribacter versatilis (strain Ellin345)
P40138 4.93e-13 70 34 1 100 1 cyaB Adenylate cyclase 2 Stigmatella aurantiaca
Q54SP4 5.95e-13 70 34 3 113 2 dhkD Hybrid signal transduction histidine kinase D Dictyostelium discoideum
Q54SP4 0.000297 45 30 1 88 2 dhkD Hybrid signal transduction histidine kinase D Dictyostelium discoideum
P0AFB8 5.98e-13 70 34 0 111 1 glnG DNA-binding transcriptional regulator NtrC Escherichia coli (strain K12)
P0AFB9 5.98e-13 70 34 0 111 3 glnG DNA-binding transcriptional regulator NtrC Escherichia coli O157:H7
P72781 6.32e-13 68 29 2 121 1 rre1 Response regulator Rre1 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P48359 9.9e-13 68 30 1 120 3 ycf29 Probable transcriptional regulator ycf29 Cyanophora paradoxa
O29221 1.23e-12 69 35 3 107 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
Q8KR08 1.34e-12 67 29 2 155 1 tmoT Response regulator protein TmoT Pseudomonas mendocina
P06534 1.92e-12 68 29 2 131 1 spo0A Stage 0 sporulation protein A Bacillus subtilis (strain 168)
P96126 2.31e-12 65 31 2 119 3 cheY Chemotaxis protein CheY Treponema pallidum (strain Nichols)
P96686 2.74e-12 67 37 3 102 3 ydfI Transcriptional regulatory protein YdfI Bacillus subtilis (strain 168)
P52941 3.35e-12 67 35 4 136 3 spo0A Stage 0 sporulation protein A homolog Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
Q0AYL3 3.91e-12 67 40 3 107 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
P62646 6.72e-12 67 37 3 108 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
P55701 7.89e-12 65 23 5 225 4 NGR_a00800 Probable transcriptional regulatory protein y4xI Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q9KS59 8.06e-12 67 34 5 161 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
B0R4K1 9.13e-12 63 34 0 102 1 cheY Chemotaxis protein CheY Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)
Q12YX1 1.12e-11 66 29 4 147 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M)
P9WGM3 1.23e-11 65 37 4 110 1 pdtaR Transcriptional regulatory protein PdtaR Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM2 1.23e-11 65 37 4 110 3 pdtaR Transcriptional regulatory protein PdtaR Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q67P67 1.48e-11 66 36 4 109 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
P03029 1.68e-11 66 34 0 108 1 ntrC DNA-binding transcriptional regulator NtrC Klebsiella pneumoniae
P58253 2.92e-11 65 35 3 117 3 spo0A Stage 0 sporulation protein A homolog Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q8EQQ3 3.62e-11 64 34 2 123 3 lytT Sensory transduction protein LytT Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
P28787 4.44e-11 65 33 0 112 3 ntrC DNA-binding transcriptional regulator NtrC Proteus hauseri
P0AEV3 4.62e-11 64 35 0 101 3 rssB Regulator of RpoS Shigella flexneri
P0AEV1 4.62e-11 64 35 0 101 1 rssB Regulator of RpoS Escherichia coli (strain K12)
P0AEV2 4.62e-11 64 35 0 101 3 rssB Regulator of RpoS Escherichia coli O157:H7
Q56128 5.44e-11 65 32 0 123 3 rcsC Sensor histidine kinase RcsC Salmonella typhi
Q8D4U6 5.45e-11 63 35 5 139 3 VV2_1193 Uncharacterized response regulatory protein VV2_1193 Vibrio vulnificus (strain CMCP6)
P10576 6.64e-11 64 30 2 135 3 ntrC DNA-binding transcriptional regulator NtrC Bradyrhizobium sp. (strain RP501 Parasponia)
P58662 9.83e-11 64 32 0 123 3 rcsC Sensor histidine kinase RcsC Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q2FMT2 1.3e-10 63 35 3 114 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1)
Q8Z333 1.5e-10 63 29 2 143 3 zraR Transcriptional regulatory protein ZraR Salmonella typhi
P15940 1.57e-10 62 28 0 101 3 nodW Nodulation protein W Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
P25852 1.59e-10 63 29 2 143 1 zraR Transcriptional regulatory protein ZraR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8TUQ0 1.6e-10 63 37 3 109 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q04848 1.77e-10 63 29 0 107 3 ntrC DNA-binding transcriptional regulator NtrC Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
P0AFU5 1.8e-10 63 34 0 100 1 qseF Transcriptional regulatory protein QseF Escherichia coli O157:H7
P0AFU4 1.8e-10 63 34 0 100 1 glrR Transcriptional regulatory protein GlrR Escherichia coli (strain K12)
Q8PX96 2.01e-10 63 34 5 146 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
P52929 2.06e-10 61 35 2 119 3 spo0A Stage 0 sporulation protein A (Fragment) Brevibacillus parabrevis
Q2KCH7 2.12e-10 60 30 2 118 3 cheY Probable chemotaxis protein CheY Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
P51343 2.41e-10 61 27 5 197 3 ycf29 Probable transcriptional regulator ycf29 Porphyra purpurea
Q65JK6 2.43e-10 62 32 6 144 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
P0DMC5 3.24e-10 62 30 0 123 1 rcsC Sensor histidine kinase RcsC Escherichia coli (strain K12)
A6X580 4.91e-10 58 31 3 117 3 divK Polar-differentiation response regulator DivK Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
Q9KA55 5.07e-10 61 34 3 108 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
P0DMI2 5.28e-10 61 36 4 106 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
B0R4K0 5.28e-10 61 36 4 106 1 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)
Q8X613 5.28e-10 62 28 1 140 3 zraR Transcriptional regulatory protein ZraR Escherichia coli O157:H7
Q04849 5.41e-10 62 31 2 122 3 ntrX Nitrogen assimilation regulatory protein NtrX Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
Q9WY30 5.97e-10 61 32 4 128 1 TM_0186 Cyclic di-GMP phosphodiesterase TM_0186 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
P14375 6.14e-10 61 28 2 143 1 zraR Transcriptional regulatory protein ZraR Escherichia coli (strain K12)
Q2RRX2 6.85e-10 61 27 7 216 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
O83639 7.17e-10 61 30 4 122 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Treponema pallidum (strain Nichols)
P0DMC6 7.31e-10 62 29 0 125 1 rcsC Sensor histidine kinase RcsC Escherichia coli
P52936 8.94e-10 60 35 3 117 3 spo0A Stage 0 sporulation protein A homolog Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
Q86AT9 1.14e-09 61 33 2 110 3 dhkI-1 Hybrid signal transduction histidine kinase I Dictyostelium discoideum
Q2ILG8 1.17e-09 60 30 4 113 3 cheB6 Protein-glutamate methylesterase/protein-glutamine glutaminase 6 Anaeromyxobacter dehalogenans (strain 2CP-C)
P52931 1.26e-09 59 28 2 122 3 spo0A Stage 0 sporulation protein A (Fragment) Niallia circulans
P39486 1.64e-09 59 33 4 111 3 dctR Probable C4-dicarboxylate response regulator DctR Priestia megaterium
P42012 1.85e-09 59 32 2 116 3 spo0A Stage 0 sporulation protein A Lysinibacillus sphaericus
P10577 1.88e-09 60 29 0 106 1 ntrC DNA-binding transcriptional regulator NtrC Rhizobium meliloti (strain 1021)
Q9APD9 1.97e-09 60 34 0 101 3 zraR Transcriptional regulatory protein ZraR Klebsiella oxytoca
Q1D359 2.21e-09 60 34 2 104 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Myxococcus xanthus (strain DK1622)
P52940 2.37e-09 59 28 2 136 3 spo0A Stage 0 sporulation protein A homolog Clostridium pasteurianum
Q30RX5 2.48e-09 59 35 5 136 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251)
P52938 2.81e-09 59 38 2 107 3 spo0A Stage 0 sporulation protein A homolog Clostridioides difficile
Q46DT6 3.23e-09 59 38 3 109 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Methanosarcina barkeri (strain Fusaro / DSM 804)
Q9K998 3.45e-09 58 29 5 166 3 dctR Probable C4-dicarboxylate response regulator DctR Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q9ZM64 3.67e-09 56 27 3 119 3 cheY1 Chemotaxis protein CheY1 Helicobacter pylori (strain J99 / ATCC 700824)
P52928 4.82e-09 58 28 2 126 3 spo0A Stage 0 sporulation protein A Bacillus anthracis
Q5L0L0 4.94e-09 58 32 3 108 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Geobacillus kaustophilus (strain HTA426)
Q3ADA6 5.05e-09 58 33 4 125 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
Q7CQM8 5.5e-09 57 29 0 107 1 ttrR Tetrathionate response regulatory protein TtrR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P71403 5.68e-09 55 27 3 119 1 cheY1 Chemotaxis protein CheY1 Helicobacter pylori (strain ATCC 700392 / 26695)
P45671 5.77e-09 58 29 3 154 3 ntrC DNA-binding transcriptional regulator NtrC Azospirillum brasilense
Q1CWZ9 6.3e-09 58 32 4 128 3 cheB5 Protein-glutamate methylesterase/protein-glutamine glutaminase 5 Myxococcus xanthus (strain DK1622)
Q9KL96 6.49e-09 58 25 4 167 3 VC_A0850 Uncharacterized response regulatory protein VC_A0850 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q51455 6.89e-09 55 27 2 122 3 cheY Chemotaxis protein CheY Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q2INJ8 7.34e-09 58 34 3 104 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Anaeromyxobacter dehalogenans (strain 2CP-C)
P0A4I4 7.58e-09 57 28 2 123 3 spo0A Stage 0 sporulation protein A Bacillus thuringiensis
P0A4I3 7.58e-09 57 28 2 123 3 spo0A Stage 0 sporulation protein A Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q3SVA1 1.33e-08 57 30 3 115 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
Q9HU19 1.33e-08 57 26 0 102 3 dctD C4-dicarboxylate transport transcriptional regulatory protein DctD Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P18769 1.33e-08 58 28 1 103 1 frzE Gliding motility regulatory protein Myxococcus xanthus
Q3IDZ3 1.35e-08 57 30 5 148 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Pseudoalteromonas translucida (strain TAC 125)
P10046 1.53e-08 57 26 1 123 3 dctD C4-dicarboxylate transport transcriptional regulatory protein DctD Rhizobium leguminosarum
O25153 1.59e-08 57 29 3 102 1 cheAY Sensor histidine kinase CheAY Helicobacter pylori (strain ATCC 700392 / 26695)
Q8FW53 1.65e-08 54 29 3 117 3 divK Polar-differentiation response regulator DivK Brucella suis biovar 1 (strain 1330)
A9WYT1 1.65e-08 54 29 3 117 3 divK Polar-differentiation response regulator DivK Brucella suis (strain ATCC 23445 / NCTC 10510)
A5VUU3 1.65e-08 54 29 3 117 3 divK Polar-differentiation response regulator DivK Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q8YC73 1.65e-08 54 29 3 117 3 divK Polar-differentiation response regulator DivK Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
A9MBQ2 1.65e-08 54 29 3 117 3 divK Polar-differentiation response regulator DivK Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q7BBW0 1.65e-08 54 29 3 117 1 divK Polar-differentiation response regulator DivK Brucella abortus biovar 1 (strain 9-941)
Q2YKN1 1.65e-08 54 29 3 117 3 divK Polar-differentiation response regulator DivK Brucella abortus (strain 2308)
B2SB45 1.65e-08 54 29 3 117 3 divK Polar-differentiation response regulator DivK Brucella abortus (strain S19)
P13632 3.13e-08 56 27 1 122 1 dctD C4-dicarboxylate transport transcriptional regulatory protein DctD Rhizobium meliloti (strain 1021)
P52932 3.33e-08 55 29 2 120 3 spo0A Stage 0 sporulation protein A (Fragment) Priestia megaterium
Q5E3S1 3.59e-08 56 30 3 130 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q1RJS1 3.87e-08 56 32 1 104 3 RBE_0312 Putative response regulator NtrX-like Rickettsia bellii (strain RML369-C)
P62647 4.12e-08 56 33 5 126 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Methanococcus maripaludis (strain DSM 14266 / JCM 13030 / NBRC 101832 / S2 / LL)
Q8Q009 4.13e-08 56 28 5 153 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q3IRR4 4.19e-08 56 32 5 117 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Natronomonas pharaonis (strain ATCC 35678 / DSM 2160 / CIP 103997 / JCM 8858 / NBRC 14720 / NCIMB 2260 / Gabara)
Q05522 4.37e-08 56 33 4 109 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Bacillus subtilis (strain 168)
Q9KQD5 4.44e-08 53 27 2 122 1 VC_2065 Chemotaxis protein CheY-3 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A0A0H3AMJ9 4.44e-08 53 27 2 122 1 cheY-3 Chemotaxis protein CheY-3 Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
P23221 5.07e-08 54 26 0 117 3 fixJ Transcriptional regulatory protein FixJ Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q5A872 5.18e-08 56 34 3 109 1 SLN1 Histidine protein kinase SLN1 Candida albicans (strain SC5314 / ATCC MYA-2876)
Q9KM66 5.59e-08 56 30 2 104 1 cqsS CAI-1 autoinducer sensor kinase/phosphatase CqsS Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P72253 6.11e-08 55 31 3 113 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase of group 2 operon Rhodospirillum centenum (strain ATCC 51521 / SW)
P0C5S5 6.43e-08 55 25 1 126 3 luxO Luminescence regulatory protein LuxO Vibrio harveyi
A7MVC2 6.43e-08 55 25 1 126 1 luxO Luminescence regulatory protein LuxO Vibrio campbellii (strain ATCC BAA-1116)
Q8TLG9 6.8e-08 55 28 5 153 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q54Q69 6.97e-08 56 33 2 118 3 dhkG Hybrid signal transduction histidine kinase G Dictyostelium discoideum
P94514 7.18e-08 54 26 4 131 3 lytT Sensory transduction protein LytT Bacillus subtilis (strain 168)
Q8RAZ3 7.25e-08 55 34 3 108 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q7A0I0 7.25e-08 54 26 5 175 3 vraR Response regulator protein VraR Staphylococcus aureus (strain MW2)
Q6G850 7.25e-08 54 26 5 175 3 vraR Response regulator protein VraR Staphylococcus aureus (strain MSSA476)
Q6GFH3 7.25e-08 54 26 5 175 3 vraR Response regulator protein VraR Staphylococcus aureus (strain MRSA252)
Q7A4R9 7.25e-08 54 26 5 175 1 vraR Response regulator protein VraR Staphylococcus aureus (strain N315)
Q7A2Q1 7.25e-08 54 26 5 175 1 vraR Response regulator protein VraR Staphylococcus aureus (strain Mu50 / ATCC 700699)
P0C0Z1 7.25e-08 54 26 5 175 3 vraR Response regulator protein VraR Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q87MX7 7.26e-08 55 25 1 126 3 luxO Regulatory protein LuxO Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
P38889 7.47e-08 55 29 1 121 1 SKN7 Transcription factor SKN7 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q2YIF7 7.5e-08 52 34 0 79 1 cpdR Response regulator receiver protein CpdR Brucella abortus (strain 2308)
P26487 7.56e-08 54 22 5 222 3 fixJ Transcriptional regulatory protein FixJ Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
Q9ZCY9 7.69e-08 55 33 1 106 3 RP562 Putative response regulator NtrX-like Rickettsia prowazekii (strain Madrid E)
Q7MIQ5 8.31e-08 55 33 2 106 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Vibrio vulnificus (strain YJ016)
Q39T95 8.38e-08 55 30 3 110 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
Q4UL27 8.84e-08 55 32 1 106 3 RF_0895 Putative response regulator NtrX-like Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
Q8DB67 8.87e-08 55 33 2 106 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Vibrio vulnificus (strain CMCP6)
Q5V0B3 9.63e-08 55 30 3 107 1 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809)
P30855 1.04e-07 55 28 1 127 1 evgS Sensor protein EvgS Escherichia coli (strain K12)
Q68WH4 1.05e-07 55 33 1 106 3 RT0550 Putative response regulator NtrX-like Rickettsia typhi (strain ATCC VR-144 / Wilmington)
A1W0A5 1.1e-07 52 30 3 107 3 cheY Chemotaxis protein CheY homolog Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
P0C635 1.1e-07 52 30 3 107 3 cheY Chemotaxis protein CheY homolog Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
A8FMH1 1.1e-07 52 30 3 107 3 cheY Chemotaxis protein CheY homolog Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
Q6K9T0 1.18e-07 52 30 2 109 2 RR3 Two-component response regulator ORR3 Oryza sativa subsp. japonica
Q4GZK8 1.18e-07 52 30 2 109 2 RR3 Two-component response regulator ORR3 Oryza sativa subsp. indica
Q92HC2 1.22e-07 55 31 1 106 3 RC0849 Putative response regulator NtrX-like Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Q9KQD8 1.23e-07 54 33 2 106 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q54RP6 1.27e-07 55 31 4 126 3 dhkL Hybrid signal transduction histidine kinase L Dictyostelium discoideum
Q1QI44 1.3e-07 54 29 3 115 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
Q311M8 1.44e-07 54 28 6 138 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
Q5A599 1.48e-07 55 28 1 112 1 NIK1 Histidine protein kinase NIK1 Candida albicans (strain SC5314 / ATCC MYA-2876)
P58402 1.64e-07 55 28 0 115 3 evgS Sensor protein EvgS Escherichia coli O157:H7
Q5HKE0 1.7e-07 53 30 2 131 3 SERP2406 Uncharacterized response regulatory protein SERP2406 Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q6AJV3 1.7e-07 54 33 3 106 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Desulfotalea psychrophila (strain LSv54 / DSM 12343)
Q9C5U0 2.12e-07 54 30 2 113 1 AHK4 Histidine kinase 4 Arabidopsis thaliana
P39048 2.16e-07 54 24 1 104 2 patA Protein PatA Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
P0DOA0 2.36e-07 54 28 3 116 1 cckA Sensor kinase CckA Brucella abortus (strain 2308)
Q75KW7 2.48e-07 51 30 3 109 3 RR41 Two-component response regulator ORR41 Oryza sativa subsp. japonica
P24086 2.69e-07 51 33 6 132 4 LA_2151 Uncharacterized protein LA_2151 Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q72RH6 2.69e-07 51 33 6 132 3 LIC_11769 Uncharacterized protein LIC_11769 Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
Q1IQS9 2.73e-07 53 30 3 106 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Koribacter versatilis (strain Ellin345)
Q87MK5 3.09e-07 53 31 2 106 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q5A4X5 3.14e-07 53 29 0 101 3 SKN7 Transcription factor SKN7 Candida albicans (strain SC5314 / ATCC MYA-2876)
Q54YH4 3.18e-07 54 29 1 120 1 dhkB Hybrid signal transduction histidine kinase B Dictyostelium discoideum
P45709 3.61e-07 50 28 1 103 3 ccdB Protein CcdB Bacillus subtilis (strain 168)
Q54SK5 3.91e-07 53 28 2 108 3 dhkM Hybrid signal transduction histidine kinase M Dictyostelium discoideum
Q0A9Z5 4.18e-07 53 31 3 106 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
P26319 4.18e-07 52 25 2 141 3 fimZ Fimbriae Z protein Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q6LTM2 4.4e-07 53 28 5 160 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Photobacterium profundum (strain SS9)
Q23917 4.62e-07 53 24 4 130 1 regA 3',5'-cyclic-nucleotide phosphodiesterase regA Dictyostelium discoideum
Q24T61 4.64e-07 53 35 4 121 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Desulfitobacterium hafniense (strain Y51)
B8AEH1 5.15e-07 53 28 2 125 3 RR23 Two-component response regulator ORR23 Oryza sativa subsp. indica
Q20YL8 5.22e-07 53 30 3 115 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Rhodopseudomonas palustris (strain BisB18)
Q6K8X6 5.39e-07 53 28 2 125 2 RR23 Two-component response regulator ORR23 Oryza sativa subsp. japonica
Q0AWZ8 5.76e-07 52 30 3 120 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
Q8F6P9 5.81e-07 52 29 3 112 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
P62641 5.81e-07 52 29 3 112 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
Q86CZ2 5.85e-07 53 29 2 122 1 dhkK Hybrid signal transduction histidine kinase K Dictyostelium discoideum
Q1BRL2 6.06e-07 52 31 4 107 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Burkholderia orbicola (strain AU 1054)
Q0HIF6 6.42e-07 52 30 6 140 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Shewanella sp. (strain MR-4)
Q2WAJ8 6.45e-07 52 28 3 107 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
P48027 6.87e-07 53 28 2 135 3 gacS Sensor protein GacS Pseudomonas syringae pv. syringae
Q87K77 6.92e-07 52 32 3 119 3 VPA0021 Uncharacterized response regulatory protein VPA0021 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q0HVI0 6.98e-07 52 30 6 140 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Shewanella sp. (strain MR-7)
Q6GK93 7.35e-07 52 31 3 125 3 hptR Transcriptional regulatory protein HptR Staphylococcus aureus (strain MRSA252)
Q2YV56 7.35e-07 52 31 3 125 3 hptR Transcriptional regulatory protein HptR Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q1GZZ0 7.79e-07 52 29 7 151 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
Q8EEQ0 7.88e-07 52 33 5 107 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q9I6V9 7.92e-07 52 31 6 129 1 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q2LR65 8.39e-07 52 32 4 107 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Syntrophus aciditrophicus (strain SB)
Q8NYJ9 8.48e-07 52 31 3 125 3 hptR Transcriptional regulatory protein HptR Staphylococcus aureus (strain MW2)
Q6GCQ3 8.48e-07 52 31 3 125 3 hptR Transcriptional regulatory protein HptR Staphylococcus aureus (strain MSSA476)
Q5HJF7 8.48e-07 52 31 3 125 2 hptR Transcriptional regulatory protein HptR Staphylococcus aureus (strain COL)
Q2G1E1 8.48e-07 52 31 3 125 1 hptR Transcriptional regulatory protein HptR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FK47 8.48e-07 52 31 3 125 3 hptR Transcriptional regulatory protein HptR Staphylococcus aureus (strain USA300)
Q31HL9 8.62e-07 52 35 4 107 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
P0A2D5 8.75e-07 50 27 2 118 1 cheY Chemotaxis protein CheY Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2D6 8.75e-07 50 27 2 118 3 cheY Chemotaxis protein CheY Salmonella typhi
Q8CQE3 9.91e-07 51 29 2 131 3 SE_0165 Uncharacterized response regulatory protein SE_0165 Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q869S5 1.02e-06 52 29 6 135 1 dokA Hybrid signal transduction protein dokA Dictyostelium discoideum
Q9F8D7 1.03e-06 52 33 2 92 3 gacS Sensor histidine kinase GacS Pseudomonas protegens (strain DSM 19095 / LMG 27888 / CFBP 6595 / CHA0)
Q39SY1 1.14e-06 52 31 4 107 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
P45365 1.14e-06 52 28 1 103 3 None Uncharacterized 76.5 kDa protein in phbC 3'region Thiocystis violacea
Q9KT84 1.15e-06 52 25 0 94 1 luxO Regulatory protein LuxO Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q2SFK0 1.16e-06 52 34 3 108 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Hahella chejuensis (strain KCTC 2396)
P0AE69 1.19e-06 49 27 2 118 3 cheY Chemotaxis protein CheY Shigella flexneri
P0AE67 1.19e-06 49 27 2 118 1 cheY Chemotaxis protein CheY Escherichia coli (strain K12)
P0AE68 1.19e-06 49 27 2 118 3 cheY Chemotaxis protein CheY Escherichia coli O157:H7
Q8FGP6 1.29e-06 49 27 2 118 3 cheY Chemotaxis protein CheY Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS10180
Feature type CDS
Gene -
Product response regulator transcription factor
Location 146869 - 147552 (strand: -1)
Length 684 (nucleotides) / 227 (amino acids)
In genomic island GI65

Contig

Accession NZ_VXKB01000002
Length 573139 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_230
Orthogroup size 8
N. genomes 6

Actions

Genomic region

Domains

PF00072 Response regulator receiver domain
PF00486 Transcriptional regulatory protein, C terminal

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0745 Signal transduction mechanisms (T)
Transcription (K)
TK DNA-binding response regulator, OmpR family, contains REC and winged-helix (wHTH) domain

Protein Sequence

MKILIAEDDIHIRNGLSDMLSSEGYTIITAENGKVALAKYQQEQPDFLILDIMMPELDGYSVCKEIRKSDEHTPIVFLSAKGDEIDKVLGLELGADDYINKPFGIHEVRARIKTIARRCLKTRHNSPDQPFQFGDLRVYPAELCAKRGQQVIELSLREIKILMCLWQHKNQVVTRDMLFDYAWGYDHLPNSRTLDQYISKLRKLIEPDPVTPILIKTIHSAGYRYQE

Flanking regions ( +/- flanking 50bp)

TCCCCTAAGCTGAAAAAGAACGGACAGCATGATGGTATGGATAAATAACGATGAAAATTTTAATTGCTGAAGACGATATTCATATTCGTAATGGATTGAGCGATATGCTCTCCTCCGAAGGTTACACCATTATTACGGCTGAAAACGGTAAAGTAGCATTAGCGAAATATCAGCAAGAACAACCAGACTTCCTTATTCTGGATATTATGATGCCTGAATTAGATGGCTACTCGGTGTGCAAAGAAATCAGAAAGAGTGATGAACATACGCCTATTGTTTTTCTCTCCGCCAAAGGAGACGAAATTGACAAAGTACTGGGTCTTGAGTTGGGGGCCGATGACTATATCAATAAGCCTTTTGGTATTCATGAAGTCCGCGCCAGAATTAAAACCATCGCCCGCCGCTGCCTGAAAACCAGGCACAATTCACCGGATCAACCTTTCCAATTCGGCGATCTGCGGGTATATCCGGCTGAGCTCTGTGCAAAACGCGGACAGCAGGTCATTGAATTATCCCTGCGCGAAATTAAAATTCTGATGTGCCTGTGGCAGCATAAAAATCAGGTCGTCACCCGCGATATGCTGTTTGATTACGCCTGGGGCTATGACCACCTGCCTAACAGCCGCACACTGGACCAATACATTTCCAAACTACGTAAACTCATTGAGCCGGACCCGGTTACTCCAATACTAATTAAAACCATACACAGTGCCGGTTACCGTTATCAGGAATAACGGTATTGCTGCAAAGTTTGAATTGTCCACTTCCCCTTATCTGAAACAGT