Homologs in group_241

Help

7 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_02140 FBDBKF_02140 56.8 Morganella morganii S1 ompR DNA-binding response regulator, OmpR family, contains REC and winged-helix (wHTH) domain
EHELCC_02610 EHELCC_02610 56.8 Morganella morganii S2 ompR DNA-binding response regulator, OmpR family, contains REC and winged-helix (wHTH) domain
NLDBIP_00850 NLDBIP_00850 56.8 Morganella morganii S4 ompR DNA-binding response regulator, OmpR family, contains REC and winged-helix (wHTH) domain
LHKJJB_01185 LHKJJB_01185 56.8 Morganella morganii S3 ompR DNA-binding response regulator, OmpR family, contains REC and winged-helix (wHTH) domain
HKOGLL_01225 HKOGLL_01225 56.8 Morganella morganii S5 ompR DNA-binding response regulator, OmpR family, contains REC and winged-helix (wHTH) domain
F4V73_RS04490 F4V73_RS04490 55.2 Morganella psychrotolerans hprR response regulator transcription factor HprR
F4V73_RS10180 F4V73_RS10180 31.8 Morganella psychrotolerans - response regulator transcription factor

Distribution of the homologs in the orthogroup group_241

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_241

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0ACZ8 2.63e-143 402 83 0 227 1 cusR Transcriptional regulatory protein CusR Escherichia coli (strain K12)
P0ACZ9 2.63e-143 402 83 0 227 3 cusR Transcriptional regulatory protein CusR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AD00 2.63e-143 402 83 0 227 3 cusR Transcriptional regulatory protein CusR Escherichia coli O157:H7
Q9ZHD3 9.33e-124 353 76 2 227 3 silR Probable transcriptional regulatory protein SilR Salmonella typhimurium
Q02540 1.16e-96 284 60 0 226 1 copR Transcriptional activator protein CopR Pseudomonas syringae pv. tomato
P0DMK7 5.42e-93 275 60 2 223 3 irlR Transcriptional activator protein IrlR Burkholderia pseudomallei (strain K96243)
I1WSZ4 5.42e-93 275 60 2 223 3 irlR Transcriptional activator protein IrlR Burkholderia pseudomallei (strain 1026b)
Q47456 1.01e-89 266 59 1 225 3 pcoR Transcriptional regulatory protein PcoR Escherichia coli
Q44006 1.23e-88 263 57 3 223 2 czcR Transcriptional activator protein CzcR Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
P76340 1.04e-76 233 52 2 219 1 hprR Transcriptional regulatory protein HprR Escherichia coli (strain K12)
Q742C1 3.24e-55 179 43 3 227 3 mprA Response regulator MprA Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
A0QBQ9 3.24e-55 179 43 3 227 3 mprA Response regulator MprA Mycobacterium avium (strain 104)
A1KHB7 3.72e-55 179 42 3 227 3 mprA Response regulator MprA Mycobacterium bovis (strain BCG / Pasteur 1173P2)
Q7U0X4 3.72e-55 179 42 3 227 1 mprA Response regulator MprA Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WGM9 5.38e-55 178 42 3 227 1 mprA Response regulator MprA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM8 5.38e-55 178 42 3 227 3 mprA Response regulator MprA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5U123 5.38e-55 178 42 3 227 3 mprA Response regulator MprA Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
A1TEL7 2.04e-54 177 42 2 228 3 mprA Response regulator MprA Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
A0R3I8 2.38e-54 177 40 2 227 1 mprA Response regulator MprA Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
A0PWB4 2.44e-54 177 41 2 229 3 mprA Response regulator MprA Mycobacterium ulcerans (strain Agy99)
O34903 2.03e-53 174 41 2 222 3 ykoG Uncharacterized transcriptional regulatory protein YkoG Bacillus subtilis (strain 168)
Q1B3X8 4.85e-53 173 40 2 227 3 mprA Response regulator MprA Mycobacterium sp. (strain MCS)
A1UL70 4.85e-53 173 40 2 227 3 mprA Response regulator MprA Mycobacterium sp. (strain KMS)
A3Q5L9 4.85e-53 173 40 2 227 3 mprA Response regulator MprA Mycobacterium sp. (strain JLS)
L7N689 8.25e-53 174 40 2 227 1 trcR Transcriptional regulatory protein TrcR Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Q8XBS3 1.18e-52 172 42 2 221 2 qseB Transcriptional regulatory protein QseB Escherichia coli O157:H7
Q9CD68 2.54e-52 171 41 3 227 3 mprA Response regulator MprA Mycobacterium leprae (strain TN)
P66795 1.41e-50 167 40 2 221 3 qseB Transcriptional regulatory protein QseB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P66796 1.41e-50 167 40 2 221 3 qseB Transcriptional regulatory protein QseB Salmonella typhi
P52076 2.85e-50 166 41 2 221 2 qseB Transcriptional regulatory protein QseB Escherichia coli (strain K12)
Q7D9K0 2.4e-49 164 40 1 221 3 tcrA Transcriptional regulatory protein TcrA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
O07776 2.4e-49 164 40 1 221 1 tcrA Transcriptional regulatory protein TcrA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P32040 2.24e-47 159 39 3 229 3 SYNPCC7002_A0851 Probable transcriptional regulatory protein SYNPCC7002_A0851 Picosynechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)
P0C001 1.21e-46 156 38 2 220 3 arlR Response regulator ArlR Staphylococcus aureus (strain MW2)
Q6G9E6 1.21e-46 156 38 2 220 3 arlR Response regulator ArlR Staphylococcus aureus (strain MSSA476)
Q6GGZ3 1.21e-46 156 38 2 220 3 arlR Response regulator ArlR Staphylococcus aureus (strain MRSA252)
P0C000 1.21e-46 156 38 2 220 3 arlR Response regulator ArlR Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HG04 1.21e-46 156 38 2 220 3 arlR Response regulator ArlR Staphylococcus aureus (strain COL)
Q2YY03 1.21e-46 156 38 2 220 3 arlR Response regulator ArlR Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q9KJN4 1.21e-46 156 38 2 220 1 arlR Response regulator ArlR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FH23 1.21e-46 156 38 2 220 3 arlR Response regulator ArlR Staphylococcus aureus (strain USA300)
Q50136 1.21e-46 157 41 1 210 3 prrA Transcriptional regulatory protein PrrA Mycobacterium leprae (strain TN)
P45337 6.55e-46 155 38 2 221 3 qseB Transcriptional regulatory protein QseB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P9WGM1 8.46e-46 155 41 1 210 1 prrA Transcriptional regulatory protein PrrA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM0 8.46e-46 155 41 1 210 3 prrA Transcriptional regulatory protein PrrA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0A5Z7 8.46e-46 155 41 1 210 3 prrA Transcriptional regulatory protein PrrA Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
O69730 3.25e-45 153 37 2 224 1 tcrX Probable transcriptional regulatory protein TcrX Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Q99U73 1.53e-44 151 39 3 220 3 arlR Response regulator ArlR Staphylococcus aureus (strain N315)
Q49XM7 1.98e-44 151 39 2 220 3 arlR Response regulator ArlR Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q4L6C6 2.66e-44 150 37 2 220 3 arlR Response regulator ArlR Staphylococcus haemolyticus (strain JCSC1435)
P48259 1.14e-43 149 38 4 230 3 ycf27 Probable transcriptional regulator ycf27 Cyanophora paradoxa
P39663 1.52e-43 150 38 3 232 1 sphR Alkaline phosphatase synthesis transcriptional regulatory protein SphR Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q8CP82 2.66e-43 148 37 2 220 3 arlR Response regulator ArlR Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HPC3 2.81e-43 148 37 2 220 3 arlR Response regulator ArlR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
P13792 5.68e-43 148 38 2 233 1 phoP Alkaline phosphatase synthesis transcriptional regulatory protein PhoP Bacillus subtilis (strain 168)
P0A4I2 5.83e-43 147 39 4 221 3 cutR Transcriptional regulatory protein CutR Streptomyces lividans
P0A4I1 5.83e-43 147 39 4 221 3 cutR Transcriptional regulatory protein CutR Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
A6WZ81 1.49e-42 146 36 2 226 3 ctrA Cell cycle response regulator CtrA Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
O78428 2.23e-42 147 37 4 230 3 ycf27 Probable transcriptional regulator ycf27 Guillardia theta
P28257 3.2e-42 146 38 4 230 3 ycf27 Probable transcriptional regulator ycf27 Galdieria sulphuraria
Q8FZ93 5.26e-42 145 35 2 226 1 ctrA Cell cycle response regulator CtrA Brucella suis biovar 1 (strain 1330)
B0CI76 5.26e-42 145 35 2 226 3 ctrA Cell cycle response regulator CtrA Brucella suis (strain ATCC 23445 / NCTC 10510)
A5VRW9 5.26e-42 145 35 2 226 1 ctrA Cell cycle response regulator CtrA Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q7CNV1 5.26e-42 145 35 2 226 1 ctrA Cell cycle response regulator CtrA Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
A9M708 5.26e-42 145 35 2 226 3 ctrA Cell cycle response regulator CtrA Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q9ZHS1 5.26e-42 145 35 2 226 1 ctrA Cell cycle response regulator CtrA Brucella abortus biovar 1 (strain 9-941)
Q2YQA4 5.26e-42 145 35 2 226 1 ctrA Cell cycle response regulator CtrA Brucella abortus (strain 2308)
B2S753 5.26e-42 145 35 2 226 3 ctrA Cell cycle response regulator CtrA Brucella abortus (strain S19)
P51358 7.42e-42 145 37 4 230 3 ycf27 Probable transcriptional regulator ycf27 Porphyra purpurea
Q1XDC9 7.91e-42 145 38 6 231 3 ycf27 Probable transcriptional regulator ycf27 Neopyropia yezoensis
Q9I4F9 9.22e-42 144 35 1 221 1 phoP Two-component response regulator PhoP Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9I0I1 1.72e-41 143 36 1 219 1 carR Response regulator protein CarR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q52990 2.99e-41 143 37 1 223 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Rhizobium meliloti (strain 1021)
P0A4I0 3.64e-41 142 35 3 225 3 dltR Transcriptional regulatory protein DltR Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
P0A4H9 3.64e-41 142 35 3 225 3 dltR Transcriptional regulatory protein DltR Streptococcus agalactiae serotype III (strain NEM316)
P94413 4.22e-41 142 35 4 224 3 yclJ Uncharacterized transcriptional regulatory protein YclJ Bacillus subtilis (strain 168)
P9WGL9 5.13e-41 142 37 3 225 1 regX3 Sensory transduction protein RegX3 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGL8 5.13e-41 142 37 3 225 2 regX3 Sensory transduction protein RegX3 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
O07130 5.13e-41 142 37 3 225 1 regX3 Sensory transduction protein RegX3 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q9HV32 5.57e-41 142 38 2 224 1 pmrA Response regulator protein PmrA Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P37478 1.04e-40 142 38 4 231 1 walR Transcriptional regulatory protein WalR Bacillus subtilis (strain 168)
Q47744 1.34e-40 141 36 3 222 3 vanRB Regulatory protein VanRB Enterococcus faecalis (strain ATCC 700802 / V583)
Q8CQK0 1.48e-40 141 35 3 231 3 walR Transcriptional regulatory protein WalR Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HK18 1.48e-40 141 35 3 231 3 walR Transcriptional regulatory protein WalR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q7A216 2.08e-40 141 35 3 228 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain MW2)
Q9RDT5 2.08e-40 141 35 3 228 1 walR Transcriptional regulatory protein WalR Staphylococcus aureus
A8YYU1 2.08e-40 141 35 3 228 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain USA300 / TCH1516)
Q6GD72 2.08e-40 141 35 3 228 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain MSSA476)
Q6GKS7 2.08e-40 141 35 3 228 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain MRSA252)
Q7A8E1 2.08e-40 141 35 3 228 1 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain N315)
Q99XF3 2.08e-40 141 35 3 228 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QD57 2.08e-40 141 35 3 228 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain Newman)
Q5HJX7 2.08e-40 141 35 3 228 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain COL)
Q2YUQ3 2.08e-40 141 35 3 228 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain bovine RF122 / ET3-1)
A5INQ9 2.08e-40 141 35 3 228 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain JH9)
Q2G2U6 2.08e-40 141 35 3 228 1 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FKN8 2.08e-40 141 35 3 228 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain USA300)
A6TXG8 2.08e-40 141 35 3 228 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain JH1)
A7WWQ5 2.08e-40 141 35 3 228 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q4LAJ9 2.91e-40 140 35 3 231 3 walR Transcriptional regulatory protein WalR Staphylococcus haemolyticus (strain JCSC1435)
P35163 4.26e-40 140 34 4 232 1 resD Transcriptional regulatory protein ResD Bacillus subtilis (strain 168)
P28835 4.4e-40 140 36 4 230 3 ycf27 Probable transcriptional regulator ycf27 Porphyridium aerugineum
Q9F868 5.17e-40 140 37 3 226 1 regX3 Sensory transduction protein RegX3 Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q4A160 1.06e-39 139 34 3 228 3 walR Transcriptional regulatory protein WalR Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q9TLQ4 2.05e-39 139 34 4 232 3 ycf27 Probable transcriptional regulator ycf27 Cyanidium caldarium
B8H358 4.24e-39 137 34 2 228 3 ctrA Cell cycle transcriptional regulator CtrA Caulobacter vibrioides (strain NA1000 / CB15N)
P0CAW8 4.24e-39 137 34 2 228 3 ctrA Cell cycle transcriptional regulator CtrA Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q8DPL7 5.82e-39 137 35 3 229 1 walR Transcriptional regulatory protein WalR Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
A0A0H2UQ68 5.82e-39 137 35 3 229 1 walR Transcriptional regulatory protein WalR Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
A0A0H2ZN37 5.82e-39 137 35 3 229 1 walR Transcriptional regulatory protein WalR Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q7A0U4 7.16e-39 137 34 4 231 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain MW2)
Q9L524 7.16e-39 137 34 4 231 2 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus
Q6G972 7.16e-39 137 34 4 231 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain MSSA476)
Q6GGK6 7.16e-39 137 34 4 231 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain MRSA252)
Q7A5H6 7.16e-39 137 34 4 231 1 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain N315)
Q7A2R6 7.16e-39 137 34 4 231 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HFT0 7.16e-39 137 34 4 231 2 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain COL)
Q2FY79 7.16e-39 137 34 4 231 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain NCTC 8325 / PS 47)
P36556 1.53e-38 136 34 2 221 1 basR Transcriptional regulatory protein BasR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P23620 2.35e-38 135 33 2 219 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P42244 2.99e-38 135 35 3 224 3 ycbL Uncharacterized transcriptional regulatory protein YcbL Bacillus subtilis (strain 168)
Q55933 3.05e-38 135 33 3 228 1 rppA Response regulator RppA Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q01473 3.8e-38 143 37 5 233 3 rcaC Protein RcaC Microchaete diplosiphon
Q01473 1.01e-08 58 30 1 119 3 rcaC Protein RcaC Microchaete diplosiphon
Q55890 6.34e-38 135 35 3 229 1 rpaA DNA-binding dual master transcriptional regulator RpaA Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P54884 1.3e-37 133 40 3 181 3 rgx3 Sensory transduction protein RegX3 Mycobacterium leprae (strain TN)
Q31S42 1.6e-37 134 35 3 230 1 rpaA DNA-binding dual master transcriptional regulator RpaA Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q93CB8 3.03e-37 132 40 3 219 3 mtrA DNA-binding response regulator MtrA Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
P0A4H8 3.18e-37 132 33 4 229 3 ciaR Transcriptional regulatory protein CiaR Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P0A4H7 3.18e-37 132 33 4 229 3 ciaR Transcriptional regulatory protein CiaR Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
P0CL17 3.62e-37 132 36 4 226 2 tctD Transcriptional regulatory protein TctD Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
E1WA34 3.62e-37 132 36 4 226 3 tctD Transcriptional regulatory protein TctD Salmonella typhimurium (strain SL1344)
P9WGM7 3.69e-37 132 40 3 219 1 mtrA DNA-binding response regulator MtrA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM6 3.69e-37 132 40 3 219 3 mtrA DNA-binding response regulator MtrA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0A5Z5 3.69e-37 132 40 3 219 3 mtrA DNA-binding response regulator MtrA Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P45605 8.67e-37 131 32 1 220 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Klebsiella pneumoniae
Q9CCJ2 9.36e-37 131 40 3 219 3 mtrA DNA-binding response regulator MtrA Mycobacterium leprae (strain TN)
Q70FH0 1.26e-36 131 35 2 221 3 pmrA Transcriptional regulatory protein PmrA Pectobacterium parmentieri
A0QTK2 1.71e-36 130 40 3 219 1 mtrA DNA-binding response regulator MtrA Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
A0A4P7TS68 3.94e-36 130 34 3 234 1 ompR DNA-binding dual transcriptional regulator OmpR Shigella flexneri serotype 5a (strain M90T)
P0AA21 3.94e-36 130 34 3 234 3 ompR DNA-binding dual transcriptional regulator OmpR Shigella flexneri
P0AA19 3.94e-36 130 34 3 234 3 ompR DNA-binding dual transcriptional regulator OmpR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
A0A0H3NGY1 3.94e-36 130 34 3 234 3 ompR DNA-binding dual transcriptional regulator OmpR Salmonella typhimurium (strain SL1344)
P0AA20 3.94e-36 130 34 3 234 1 ompR DNA-binding dual transcriptional regulator OmpR Salmonella typhi
P0AA16 3.94e-36 130 34 3 234 1 ompR DNA-binding dual transcriptional regulator OmpR Escherichia coli (strain K12)
P0AA17 3.94e-36 130 34 3 234 3 ompR DNA-binding dual transcriptional regulator OmpR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AA18 3.94e-36 130 34 3 234 3 ompR DNA-binding dual transcriptional regulator OmpR Escherichia coli O157:H7
P30843 4.47e-36 129 34 2 221 1 basR Transcriptional regulatory protein BasR Escherichia coli (strain K12)
P45606 4.83e-36 129 32 1 220 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Shigella dysenteriae
Q04942 5.56e-36 129 38 3 224 1 afsQ1 Transcriptional regulatory protein AfsQ1 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
P0AFJ5 5.79e-36 129 32 1 220 1 phoB Phosphate regulon transcriptional regulatory protein PhoB Escherichia coli (strain K12)
P0AFJ6 5.79e-36 129 32 1 220 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Escherichia coli O157:H7
P45607 9.49e-36 129 32 1 220 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Shigella flexneri
G3XCY6 1.22e-35 129 36 4 226 1 gltR Transcriptional regulatory protein GltR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P08368 2.86e-35 127 35 3 223 1 creB Transcriptional regulatory protein CreB Escherichia coli (strain K12)
Q57QC3 2.17e-33 122 31 3 230 3 phoP Virulence transcriptional regulatory protein PhoP Salmonella choleraesuis (strain SC-B67)
P55701 4.2e-33 122 31 2 211 4 NGR_a00800 Probable transcriptional regulatory protein y4xI Sinorhizobium fredii (strain NBRC 101917 / NGR234)
P21866 4.51e-33 122 36 3 220 1 kdpE KDP operon transcriptional regulatory protein KdpE Escherichia coli (strain K12)
Q8Z7H2 5.44e-33 122 31 3 230 3 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhi
Q82EB1 5.8e-33 122 36 4 233 3 cseB Transcriptional regulatory protein CseB Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
P0DM78 9.49e-33 121 31 3 230 1 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
F5ZP95 9.49e-33 121 31 3 230 1 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhimurium (strain ATCC 68169 / UK-1)
E1WFA1 9.49e-33 121 31 3 230 2 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhimurium (strain SL1344)
D0ZV90 9.49e-33 121 31 3 230 1 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhimurium (strain 14028s / SGSC 2262)
Q5PMJ1 9.49e-33 121 31 3 230 3 phoP Virulence transcriptional regulatory protein PhoP Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q9ZEP4 1.21e-32 121 37 4 232 1 cseB Transcriptional regulatory protein CseB Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
O24973 1.48e-32 120 36 3 224 1 arsR Transcriptional regulatory protein ArsR Helicobacter pylori (strain ATCC 700392 / 26695)
Q83RR0 2.58e-32 120 30 3 230 3 phoP Virulence transcriptional regulatory protein PhoP Shigella flexneri
Q8CXZ9 2.58e-32 120 30 3 230 3 phoP Transcriptional regulatory protein PhoP Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P23836 2.73e-32 120 30 3 230 1 phoP Transcriptional regulatory protein PhoP Escherichia coli (strain K12)
Q9KM23 6.59e-32 119 37 6 228 1 vxrB Transcriptional regulatory protein VxrB Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P31079 1.87e-31 118 35 7 231 3 petR Protein PetR Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
Q9AE24 2.77e-31 117 30 4 228 3 rprY Transcriptional regulatory protein RprY Bacteroides fragilis (strain YCH46)
Q8X738 3.5e-31 117 30 3 230 3 phoP Transcriptional regulatory protein PhoP Escherichia coli O157:H7
Q8GP20 7.44e-31 116 31 4 228 1 rssB Swarming motility regulation protein RssB Serratia marcescens
Q7A1J1 9.11e-31 116 31 5 224 3 saeR Response regulator SaeR Staphylococcus aureus (strain MW2)
Q6GBC4 9.11e-31 116 31 5 224 3 saeR Response regulator SaeR Staphylococcus aureus (strain MSSA476)
Q6GIT6 9.11e-31 116 31 5 224 3 saeR Response regulator SaeR Staphylococcus aureus (strain MRSA252)
Q7A6V3 9.11e-31 116 31 5 224 1 saeR Response regulator SaeR Staphylococcus aureus (strain N315)
Q99VR7 9.11e-31 116 31 5 224 3 saeR Response regulator SaeR Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q840P8 9.11e-31 116 31 5 224 1 saeR Response regulator SaeR Staphylococcus aureus (strain Newman)
Q5HHW4 9.11e-31 116 31 5 224 1 saeR Response regulator SaeR Staphylococcus aureus (strain COL)
Q2YSM5 9.11e-31 116 31 5 224 3 saeR Response regulator SaeR Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q2G2G2 9.11e-31 116 31 5 224 1 saeR Response regulator SaeR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FIT4 9.11e-31 116 31 5 224 3 saeR Response regulator SaeR Staphylococcus aureus (strain USA300)
Q8CQ17 1.15e-30 115 32 6 227 1 saeR Response regulator SaeR Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HR28 1.15e-30 115 32 6 227 3 saeR Response regulator SaeR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
O32192 3.68e-30 114 34 5 222 1 cssR Transcriptional regulatory protein CssR Bacillus subtilis (strain 168)
P9WGN1 4.48e-30 114 32 4 224 1 kdpE Transcriptional regulatory protein KdpE Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGN0 4.48e-30 114 32 4 224 3 kdpE Transcriptional regulatory protein KdpE Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q49ZT8 2.74e-28 109 26 2 217 3 hssR Heme response regulator HssR Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
P45189 3.19e-28 109 31 4 221 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q06239 1.04e-27 108 30 4 228 3 vanR Regulatory protein VanR Enterococcus faecium
Q8CN92 3.35e-27 107 26 2 219 3 hssR Heme response regulator HssR Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HLN2 3.42e-27 106 26 2 219 3 hssR Heme response regulator HssR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q2YZ24 1.32e-26 105 27 2 222 3 hssR Heme response regulator HssR Staphylococcus aureus (strain bovine RF122 / ET3-1)
P58357 1.36e-26 105 31 4 226 3 torR TorCAD operon transcriptional regulatory protein TorR Escherichia coli O157:H7
P44895 1.67e-26 105 33 5 225 3 cpxR Transcriptional regulatory protein CpxR homolog Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P38684 2.33e-26 104 31 4 226 1 torR TorCAD operon transcriptional regulatory protein TorR Escherichia coli (strain K12)
P69228 5.43e-26 103 32 4 226 1 baeR Transcriptional regulatory protein BaeR Escherichia coli (strain K12)
P69229 5.43e-26 103 32 4 226 1 baeR Transcriptional regulatory protein BaeR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q7A039 9.33e-26 103 27 2 222 3 hssR Heme response regulator HssR Staphylococcus aureus (strain MW2)
A8Z552 9.33e-26 103 27 2 222 3 hssR Heme response regulator HssR Staphylococcus aureus (strain USA300 / TCH1516)
Q6G6V9 9.33e-26 103 27 2 222 3 hssR Heme response regulator HssR Staphylococcus aureus (strain MSSA476)
Q7A3X1 9.33e-26 103 27 2 222 3 hssR Heme response regulator HssR Staphylococcus aureus (strain N315)
Q99RR6 9.33e-26 103 27 2 222 3 hssR Heme response regulator HssR Staphylococcus aureus (strain Mu50 / ATCC 700699)
A5IVE2 9.33e-26 103 27 2 222 3 hssR Heme response regulator HssR Staphylococcus aureus (strain JH9)
Q2FVQ9 9.33e-26 103 27 2 222 3 hssR Heme response regulator HssR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FED5 9.33e-26 103 27 2 222 3 hssR Heme response regulator HssR Staphylococcus aureus (strain USA300)
A6U488 9.33e-26 103 27 2 222 3 hssR Heme response regulator HssR Staphylococcus aureus (strain JH1)
A7X5Y5 9.33e-26 103 27 2 222 3 hssR Heme response regulator HssR Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q6GE73 1.17e-25 102 27 2 222 3 hssR Heme response regulator HssR Staphylococcus aureus (strain MRSA252)
Q44929 1.24e-25 103 30 4 233 3 gtcR Response regulator GtcR Aneurinibacillus migulanus
A6QJK3 2.5e-25 102 27 2 222 1 hssR Heme response regulator HssR Staphylococcus aureus (strain Newman)
Q5HDJ4 2.5e-25 102 27 2 222 3 hssR Heme response regulator HssR Staphylococcus aureus (strain COL)
Q4L8L9 4.14e-25 101 26 2 219 3 hssR Heme response regulator HssR Staphylococcus haemolyticus (strain JCSC1435)
Q8DN02 6.74e-25 100 31 5 223 1 rr06 Response regulator RR06 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
A0A0H2ZNF6 6.74e-25 100 31 5 223 1 rr06 Response regulator RR06 Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q9HUI2 9.25e-25 100 32 6 235 3 aruR Transcriptional regulatory protein AruR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
O31432 1.5e-24 99 28 6 222 3 ybdJ Uncharacterized transcriptional regulatory protein YbdJ Bacillus subtilis (strain 168)
P94504 1.56e-24 100 28 5 223 3 yvrH Transcriptional regulatory protein YvrH Bacillus subtilis (strain 168)
Q04803 1.81e-24 101 33 3 222 3 pfeR Transcriptional activator protein PfeR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P54443 1.91e-24 99 30 6 225 3 yrkP Uncharacterized transcriptional regulatory protein YrkP Bacillus subtilis (strain 168)
P44918 3.95e-24 99 30 4 226 3 arcA Aerobic respiration control protein ArcA homolog Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A0A0H3GGB5 2.28e-23 97 32 5 229 2 cpxR Transcriptional regulatory protein CpxR Klebsiella pneumoniae subsp. pneumoniae (strain HS11286)
P0AE90 4.47e-23 96 32 5 229 3 cpxR Transcriptional regulatory protein CpxR Shigella flexneri
P0AE88 4.47e-23 96 32 5 229 1 cpxR Transcriptional regulatory protein CpxR Escherichia coli (strain K12)
P0AE89 4.47e-23 96 32 5 229 3 cpxR Transcriptional regulatory protein CpxR Escherichia coli O157:H7
P33112 6.24e-23 95 31 4 222 3 spaR Transcriptional regulatory protein SpaR Bacillus subtilis
Q2FWH6 9.72e-23 95 32 6 227 1 kdpE Transcriptional regulatory protein KdpE Staphylococcus aureus (strain NCTC 8325 / PS 47)
O06978 6.06e-22 93 29 5 229 3 yvcP Uncharacterized transcriptional regulatory protein YvcP Bacillus subtilis (strain 168)
Q4L481 8.53e-22 92 27 2 204 3 graR Response regulator protein GraR Staphylococcus haemolyticus (strain JCSC1435)
P52108 9.47e-22 92 29 5 231 1 rstA Transcriptional regulatory protein RstA Escherichia coli (strain K12)
Q07597 2.81e-21 91 29 5 225 3 nisR Nisin biosynthesis regulatory protein NisR Lactococcus lactis subsp. lactis
A8Z181 3.81e-21 90 27 4 226 3 graR Response regulator protein GraR Staphylococcus aureus (strain USA300 / TCH1516)
A6QEW8 3.81e-21 90 27 4 226 3 graR Response regulator protein GraR Staphylococcus aureus (strain Newman)
Q5HI09 3.81e-21 90 27 4 226 1 graR Response regulator protein GraR Staphylococcus aureus (strain COL)
Q2G0E0 3.81e-21 90 27 4 226 1 graR Response regulator protein GraR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FIY0 3.81e-21 90 27 4 226 3 graR Response regulator protein GraR Staphylococcus aureus (strain USA300)
Q2YSS2 3.98e-21 90 27 4 226 3 graR Response regulator protein GraR Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q6GJ11 5.16e-21 90 27 2 222 3 graR Response regulator protein GraR Staphylococcus aureus (strain MRSA252)
Q7A1L2 5.62e-21 90 27 4 226 3 graR Response regulator protein GraR Staphylococcus aureus (strain MW2)
Q6GBH1 5.62e-21 90 27 4 226 3 graR Response regulator protein GraR Staphylococcus aureus (strain MSSA476)
Q99VW2 5.62e-21 90 27 4 226 3 graR Response regulator protein GraR Staphylococcus aureus (strain N315)
A5IQL2 5.62e-21 90 27 4 226 3 graR Response regulator protein GraR Staphylococcus aureus (strain JH9)
A6TZD6 5.62e-21 90 27 4 226 3 graR Response regulator protein GraR Staphylococcus aureus (strain JH1)
A7WZC3 5.62e-21 90 27 4 226 3 graR Response regulator protein GraR Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q932F1 6.85e-21 90 27 4 226 1 graR Response regulator protein GraR Staphylococcus aureus (strain Mu50 / ATCC 700699)
P0A9Q4 2.96e-20 89 29 4 226 3 arcA Aerobic respiration control protein ArcA Shigella flexneri
P0A9Q1 2.96e-20 89 29 4 226 1 arcA Aerobic respiration control protein ArcA Escherichia coli (strain K12)
P0A9Q2 2.96e-20 89 29 4 226 3 arcA Aerobic respiration control protein ArcA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0A9Q3 2.96e-20 89 29 4 226 3 arcA Aerobic respiration control protein ArcA Escherichia coli O157:H7
P42421 3.51e-20 88 27 3 226 3 yxdJ Transcriptional regulatory protein YxdJ Bacillus subtilis (strain 168)
Q8CQ37 6.39e-20 87 27 2 222 3 graR Response regulator protein GraR Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HR81 6.39e-20 87 27 2 222 3 graR Response regulator protein GraR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q9K621 2.32e-19 86 28 5 207 3 bceR Sensory transduction protein BceR Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
P50350 3.55e-19 85 29 5 234 3 chvI Transcriptional regulatory protein ChvI Rhizobium meliloti (strain 1021)
P13359 4.98e-19 85 32 8 229 3 virG Regulatory protein VirG Rhizobium rhizogenes
Q07783 5.35e-19 85 28 5 235 3 chvI Transcriptional regulatory protein ChvI Rhizobium radiobacter
Q49VK3 7.6e-19 84 26 4 208 3 graR Response regulator protein GraR Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
O25918 8.04e-19 84 27 5 221 3 crdR Transcriptional regulatory protein CrdR Helicobacter pylori (strain ATCC 700392 / 26695)
Q1XDE4 1.23e-18 84 33 4 163 3 ycf29 Probable transcriptional regulator ycf29 Neopyropia yezoensis
Q05943 5.49e-18 83 32 5 194 3 glnR Transcriptional regulatory protein GlnR Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
P62722 1.15e-17 82 37 8 174 3 virG Regulatory protein VirG Agrobacterium tumefaciens (strain 15955)
Q44444 1.18e-17 82 37 8 174 3 virG Regulatory protein VirG Rhizobium radiobacter
P07545 7.46e-17 80 36 8 174 3 virG Regulatory protein VirG Agrobacterium fabrum (strain C58 / ATCC 33970)
P50351 9.6e-17 79 28 4 235 3 chvI Transcriptional regulatory protein ChvI Sinorhizobium fredii (strain NBRC 101917 / NGR234)
O34951 5.65e-16 77 26 7 232 3 bceR Sensory transduction protein BceR Bacillus subtilis (strain 168)
P10577 5.31e-15 76 36 0 108 1 ntrC DNA-binding transcriptional regulator NtrC Rhizobium meliloti (strain 1021)
P72781 7.81e-14 71 34 2 124 1 rre1 Response regulator Rre1 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q06065 7.87e-14 73 32 0 107 1 atoC Regulatory protein AtoC Escherichia coli (strain K12)
P51343 1.04e-12 67 33 1 120 3 ycf29 Probable transcriptional regulator ycf29 Porphyra purpurea
Q04848 2.8e-12 68 31 0 108 3 ntrC DNA-binding transcriptional regulator NtrC Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
P10576 3.69e-12 68 31 0 108 3 ntrC DNA-binding transcriptional regulator NtrC Bradyrhizobium sp. (strain RP501 Parasponia)
O05251 5.36e-12 66 37 2 107 3 malR Transcriptional regulatory protein MalR Bacillus subtilis (strain 168)
Q54SP4 6.29e-12 68 35 2 116 2 dhkD Hybrid signal transduction histidine kinase D Dictyostelium discoideum
B8GZM2 6.67e-12 67 33 1 118 1 pleD Response regulator PleD Caulobacter vibrioides (strain NA1000 / CB15N)
Q9A5I5 6.67e-12 67 33 1 118 1 pleD Response regulator PleD Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q9KQD5 1.91e-11 62 31 2 121 1 VC_2065 Chemotaxis protein CheY-3 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A0A0H3AMJ9 1.91e-11 62 31 2 121 1 cheY-3 Chemotaxis protein CheY-3 Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
P14375 9.1e-11 64 29 0 124 1 zraR Transcriptional regulatory protein ZraR Escherichia coli (strain K12)
Q9APD9 1.15e-10 63 31 0 106 3 zraR Transcriptional regulatory protein ZraR Klebsiella oxytoca
P48359 2.64e-10 61 30 1 124 3 ycf29 Probable transcriptional regulator ycf29 Cyanophora paradoxa
P52931 3.32e-10 61 30 1 102 3 spo0A Stage 0 sporulation protein A (Fragment) Niallia circulans
Q8X613 3.52e-10 62 29 0 124 3 zraR Transcriptional regulatory protein ZraR Escherichia coli O157:H7
Q9WY30 4.17e-10 62 31 1 117 1 TM_0186 Cyclic di-GMP phosphodiesterase TM_0186 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q51455 8.57e-10 58 28 2 121 3 cheY Chemotaxis protein CheY Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q8KIY1 9.37e-10 61 32 2 117 1 tmoS Sensor histidine kinase TmoS Pseudomonas mendocina
Q9KSB1 1.3e-09 60 28 2 118 1 VC_1348 Probable cyclic di-GMP phosphodiesterase VC_1348 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P58402 1.59e-09 60 32 0 115 3 evgS Sensor protein EvgS Escherichia coli O157:H7
P45671 1.77e-09 60 31 0 122 3 ntrC DNA-binding transcriptional regulator NtrC Azospirillum brasilense
E0X9C7 2.08e-09 60 32 2 117 1 todS Sensor histidine kinase TodS Pseudomonas putida (strain DOT-T1E)
P09432 2.48e-09 60 30 0 110 3 ntrC DNA-binding transcriptional regulator NtrC Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
Q54Q69 2.78e-09 60 33 2 113 3 dhkG Hybrid signal transduction histidine kinase G Dictyostelium discoideum
P23221 3.17e-09 58 27 0 117 3 fixJ Transcriptional regulatory protein FixJ Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
P30855 4e-09 59 31 0 115 1 evgS Sensor protein EvgS Escherichia coli (strain K12)
Q9I4N3 4.2e-09 59 30 1 113 1 fleR Response regulator protein FleR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
T2KMF4 5e-09 59 31 2 116 3 BN863_21930 Histidine kinase P4 Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1)
P52938 5.04e-09 58 27 3 142 3 spo0A Stage 0 sporulation protein A homolog Clostridioides difficile
P40138 5.51e-09 58 27 4 130 1 cyaB Adenylate cyclase 2 Stigmatella aurantiaca
B0R4K1 5.91e-09 55 25 0 115 1 cheY Chemotaxis protein CheY Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)
P51586 6.13e-09 55 32 1 115 3 None Uncharacterized 14.6 kDa protein in sodA1 3'region Leptolyngbya boryana
Q9ZM64 6.3e-09 55 27 3 120 3 cheY1 Chemotaxis protein CheY1 Helicobacter pylori (strain J99 / ATCC 700824)
Q8FGP6 6.52e-09 55 27 2 121 3 cheY Chemotaxis protein CheY Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P96126 7.76e-09 55 27 2 119 3 cheY Chemotaxis protein CheY Treponema pallidum (strain Nichols)
A5W4E3 9.51e-09 58 31 2 117 1 todS Sensor histidine kinase TodS Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
P46384 9.57e-09 55 30 5 133 1 pilG Protein PilG Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P0C5S5 1.22e-08 58 23 0 123 3 luxO Luminescence regulatory protein LuxO Vibrio harveyi
A7MVC2 1.22e-08 58 23 0 123 1 luxO Luminescence regulatory protein LuxO Vibrio campbellii (strain ATCC BAA-1116)
P18769 1.36e-08 58 32 3 114 1 frzE Gliding motility regulatory protein Myxococcus xanthus
P39486 1.4e-08 56 30 2 108 3 dctR Probable C4-dicarboxylate response regulator DctR Priestia megaterium
Q87MX7 1.4e-08 57 23 0 123 3 luxO Regulatory protein LuxO Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
P26487 1.44e-08 56 28 0 118 3 fixJ Transcriptional regulatory protein FixJ Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
P25852 1.45e-08 57 28 0 106 1 zraR Transcriptional regulatory protein ZraR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8Z333 1.53e-08 57 28 0 106 3 zraR Transcriptional regulatory protein ZraR Salmonella typhi
P0AE69 1.65e-08 54 26 2 121 3 cheY Chemotaxis protein CheY Shigella flexneri
P0AE67 1.65e-08 54 26 2 121 1 cheY Chemotaxis protein CheY Escherichia coli (strain K12)
P0AE68 1.65e-08 54 26 2 121 3 cheY Chemotaxis protein CheY Escherichia coli O157:H7
P52942 2.17e-08 54 28 0 115 3 spo0F Sporulation initiation phosphotransferase F Bacillus thuringiensis subsp. kurstaki
Q3LWR6 2.28e-08 56 24 1 162 3 todT Response regulator protein TodT Pseudomonas putida
I7CA98 2.28e-08 56 24 1 162 1 todT Response regulator protein TodT Pseudomonas putida (strain DOT-T1E)
A5W4E2 2.28e-08 56 24 1 162 1 todT Response regulator protein TodT Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q9HV27 2.39e-08 57 41 1 74 1 PA4781 Cyclic di-GMP phosphodiesterase PA4781 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P52941 2.4e-08 56 29 4 146 3 spo0A Stage 0 sporulation protein A homolog Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
P43501 2.57e-08 53 30 1 117 3 pilH Protein PilH Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P0A2D5 2.63e-08 54 26 2 121 1 cheY Chemotaxis protein CheY Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2D6 2.63e-08 54 26 2 121 3 cheY Chemotaxis protein CheY Salmonella typhi
Q7MM78 3.7e-08 56 29 0 77 3 luxO Regulatory protein LuxO Vibrio vulnificus (strain YJ016)
Q8CWJ5 3.7e-08 56 29 0 77 3 luxO Regulatory protein LuxO Vibrio vulnificus (strain CMCP6)
Q93P00 3.82e-08 53 26 2 121 3 cheY Chemotaxis protein CheY Yersinia enterocolitica
A1W0A5 4.1e-08 53 29 4 126 3 cheY Chemotaxis protein CheY homolog Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
P0C635 4.1e-08 53 29 4 126 3 cheY Chemotaxis protein CheY homolog Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
A8FMH1 4.1e-08 53 29 4 126 3 cheY Chemotaxis protein CheY homolog Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
Q9HU19 5.84e-08 55 29 2 131 3 dctD C4-dicarboxylate transport transcriptional regulatory protein DctD Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P06628 6.02e-08 53 26 0 115 1 spo0F Sporulation initiation phosphotransferase F Bacillus subtilis (strain 168)
P10046 7.76e-08 55 30 2 114 3 dctD C4-dicarboxylate transport transcriptional regulatory protein DctD Rhizobium leguminosarum
Q54YH4 8.13e-08 55 25 1 124 1 dhkB Hybrid signal transduction histidine kinase B Dictyostelium discoideum
P71403 9.57e-08 52 25 3 120 1 cheY1 Chemotaxis protein CheY1 Helicobacter pylori (strain ATCC 700392 / 26695)
Q9ZCY9 1e-07 55 27 2 122 3 RP562 Putative response regulator NtrX-like Rickettsia prowazekii (strain Madrid E)
Q5SML5 1.02e-07 55 27 2 120 2 RR22 Two-component response regulator ORR22 Oryza sativa subsp. japonica
B8B3I4 1.04e-07 55 27 2 120 3 RR22 Two-component response regulator ORR22 Oryza sativa subsp. indica
P0A4H5 1.11e-07 52 28 1 104 3 cheY Chemotaxis protein CheY Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
P0A4H6 1.11e-07 52 28 1 104 3 cheY Chemotaxis protein CheY Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q4UL27 1.18e-07 55 27 2 122 3 RF_0895 Putative response regulator NtrX-like Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
Q9FAD7 1.49e-07 52 25 2 121 3 cheY Chemotaxis protein CheY Enterobacter cloacae
Q54YZ9 1.52e-07 55 30 2 118 3 dhkJ Hybrid signal transduction histidine kinase J Dictyostelium discoideum
Q92HC2 1.52e-07 54 30 1 103 3 RC0849 Putative response regulator NtrX-like Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Q10WZ6 1.77e-07 54 32 3 106 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Trichodesmium erythraeum (strain IMS101)
O49397 1.92e-07 54 25 2 143 1 ARR10 Two-component response regulator ARR10 Arabidopsis thaliana
Q00934 3.12e-07 53 28 0 117 1 pilR Response regulator protein PilR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q53228 3.18e-07 52 25 1 125 1 regA Photosynthetic apparatus regulatory protein RegA Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
Q88RJ6 3.4e-07 53 28 0 107 3 algB Alginate biosynthesis transcriptional regulatory protein AlgB Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q9KT84 3.62e-07 53 29 0 77 1 luxO Regulatory protein LuxO Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P0AFB8 3.81e-07 53 25 0 110 1 glnG DNA-binding transcriptional regulator NtrC Escherichia coli (strain K12)
P0AFB9 3.81e-07 53 25 0 110 3 glnG DNA-binding transcriptional regulator NtrC Escherichia coli O157:H7
Q8H7S7 3.82e-07 53 28 3 112 2 RR21 Two-component response regulator ORR21 Oryza sativa subsp. japonica
A2XE31 3.82e-07 53 28 3 112 3 RR21 Two-component response regulator ORR21 Oryza sativa subsp. indica
A2X1N2 3.83e-07 53 25 3 151 3 RR24 Two-component response regulator ORR24 Oryza sativa subsp. indica
Q8FUS8 3.97e-07 52 25 3 154 3 ftcR Flagellar transcriptional regulator FtcR Brucella suis biovar 1 (strain 1330)
Q8YDL7 3.97e-07 52 25 3 154 1 ftcR Flagellar transcriptional regulator FtcR Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q576I4 3.97e-07 52 25 3 154 3 ftcR Flagellar transcriptional regulator FtcR Brucella abortus biovar 1 (strain 9-941)
Q2YJF8 3.97e-07 52 25 3 154 3 ftcR Flagellar transcriptional regulator FtcR Brucella abortus (strain 2308)
Q6H805 3.97e-07 53 25 3 151 2 RR24 Two-component response regulator ORR24 Oryza sativa subsp. japonica
P24072 4.16e-07 50 24 1 117 1 cheY Chemotaxis protein CheY Bacillus subtilis (strain 168)
Q8KR08 4.53e-07 52 32 0 71 1 tmoT Response regulator protein TmoT Pseudomonas mendocina
Q8D0P1 4.62e-07 50 24 2 121 3 cheY Chemotaxis protein CheY Yersinia pestis
A5VW00 4.67e-07 52 24 3 154 3 ftcR Flagellar transcriptional regulator FtcR Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
P0AEV3 4.87e-07 53 32 0 101 3 rssB Regulator of RpoS Shigella flexneri
P0AEV1 4.87e-07 53 32 0 101 1 rssB Regulator of RpoS Escherichia coli (strain K12)
P0AEV2 4.87e-07 53 32 0 101 3 rssB Regulator of RpoS Escherichia coli O157:H7
Q56312 6.08e-07 50 25 1 103 1 cheY Chemotaxis protein CheY Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q88AQ2 7.22e-07 52 28 0 107 3 algB Alginate biosynthesis transcriptional regulatory protein AlgB Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q86AT9 7.5e-07 53 31 4 110 3 dhkI-1 Hybrid signal transduction histidine kinase I Dictyostelium discoideum
Q5A599 8.25e-07 52 28 1 112 1 NIK1 Histidine protein kinase NIK1 Candida albicans (strain SC5314 / ATCC MYA-2876)
Q68WH4 8.42e-07 52 26 2 122 3 RT0550 Putative response regulator NtrX-like Rickettsia typhi (strain ATCC VR-144 / Wilmington)
Q9ZWS9 8.66e-07 51 31 2 86 1 ARR3 Two-component response regulator ARR3 Arabidopsis thaliana
P0C5S3 8.99e-07 51 28 0 108 3 actR Acid tolerance regulatory protein ActR Rhizobium meliloti (strain 1021)
P41789 9.9e-07 52 25 0 110 1 glnG DNA-binding transcriptional regulator NtrC Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q9FXD6 1.04e-06 52 27 3 122 1 ARR11 Two-component response regulator ARR11 Arabidopsis thaliana
Q1RJS1 1.05e-06 52 27 2 122 3 RBE_0312 Putative response regulator NtrX-like Rickettsia bellii (strain RML369-C)
A6X580 1.33e-06 49 26 3 118 3 divK Polar-differentiation response regulator DivK Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
P23747 1.36e-06 52 28 0 107 1 algB Alginate biosynthesis transcriptional regulatory protein AlgB Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q5A4X5 1.38e-06 52 28 2 110 3 SKN7 Transcription factor SKN7 Candida albicans (strain SC5314 / ATCC MYA-2876)
A6UEL7 1.55e-06 50 28 0 108 3 actR Acid tolerance regulatory protein ActR Sinorhizobium medicae (strain WSM419)
Q6LA42 1.82e-06 51 24 2 130 1 APRR5 Two-component response regulator-like APRR5 Arabidopsis thaliana
Q54RP6 1.83e-06 52 26 2 126 3 dhkL Hybrid signal transduction histidine kinase L Dictyostelium discoideum
Q2YIF7 1.94e-06 48 23 0 115 1 cpdR Response regulator receiver protein CpdR Brucella abortus (strain 2308)
O14283 1.97e-06 51 27 0 102 1 prr1 Transcription factor prr1 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
P13632 2.14e-06 51 29 2 113 1 dctD C4-dicarboxylate transport transcriptional regulatory protein DctD Rhizobium meliloti (strain 1021)
B8AEH1 2.19e-06 51 25 2 120 3 RR23 Two-component response regulator ORR23 Oryza sativa subsp. indica
Q6K8X6 2.34e-06 51 25 2 120 2 RR23 Two-component response regulator ORR23 Oryza sativa subsp. japonica
Q7CQM5 2.48e-06 50 30 2 120 1 ssrB Response regulator SsrB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P06534 2.49e-06 50 28 2 99 1 spo0A Stage 0 sporulation protein A Bacillus subtilis (strain 168)
P52934 2.51e-06 50 30 1 79 1 spo0A Stage 0 sporulation protein A Geobacillus stearothermophilus
O25153 2.81e-06 51 27 2 115 1 cheAY Sensor histidine kinase CheAY Helicobacter pylori (strain ATCC 700392 / 26695)
P03029 2.85e-06 50 26 0 108 1 ntrC DNA-binding transcriptional regulator NtrC Klebsiella pneumoniae
Q54SK5 3.78e-06 50 27 3 125 3 dhkM Hybrid signal transduction histidine kinase M Dictyostelium discoideum
Q67W50 3.79e-06 50 25 2 110 3 RR25 Two-component response regulator ORR25 Oryza sativa subsp. japonica
P28787 5.25e-06 50 22 0 109 3 ntrC DNA-binding transcriptional regulator NtrC Proteus hauseri
P0AEC4 5.57e-06 50 28 1 115 3 arcB Aerobic respiration control sensor protein ArcB Shigella flexneri
P0AEC3 5.57e-06 50 28 1 115 1 arcB Aerobic respiration control sensor protein ArcB Escherichia coli (strain K12)
P58363 5.67e-06 50 28 1 115 3 arcB Aerobic respiration control sensor protein ArcB Escherichia coli O157:H7
Q8L500 5.79e-06 50 26 2 124 1 APRR9 Two-component response regulator-like APRR9 Arabidopsis thaliana
P52940 5.85e-06 49 30 2 95 3 spo0A Stage 0 sporulation protein A homolog Clostridium pasteurianum
Q8L9Y3 6.12e-06 49 24 4 163 1 ARR14 Two-component response regulator ARR14 Arabidopsis thaliana
O82868 6.65e-06 48 25 1 125 3 regA Photosynthetic apparatus regulatory protein RegA Rhodovulum sulfidophilum
Q4L8V4 7.37e-06 49 30 4 128 3 lytR Sensory transduction protein LytR Staphylococcus haemolyticus (strain JCSC1435)
Q4UU85 7.82e-06 49 28 2 121 1 rpfG Cyclic di-GMP phosphodiesterase response regulator RpfG Xanthomonas campestris pv. campestris (strain 8004)
P38889 8e-06 49 24 0 102 1 SKN7 Transcription factor SKN7 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P42508 8.25e-06 48 26 0 100 3 regA Photosynthetic apparatus regulatory protein RegA Rhodobacter capsulatus
P62646 8.34e-06 49 30 4 114 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
Q8FW53 9.91e-06 47 25 3 118 3 divK Polar-differentiation response regulator DivK Brucella suis biovar 1 (strain 1330)
A9WYT1 9.91e-06 47 25 3 118 3 divK Polar-differentiation response regulator DivK Brucella suis (strain ATCC 23445 / NCTC 10510)
A5VUU3 9.91e-06 47 25 3 118 3 divK Polar-differentiation response regulator DivK Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q8YC73 9.91e-06 47 25 3 118 3 divK Polar-differentiation response regulator DivK Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
A9MBQ2 9.91e-06 47 25 3 118 3 divK Polar-differentiation response regulator DivK Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q7BBW0 9.91e-06 47 25 3 118 1 divK Polar-differentiation response regulator DivK Brucella abortus biovar 1 (strain 9-941)
Q2YKN1 9.91e-06 47 25 3 118 3 divK Polar-differentiation response regulator DivK Brucella abortus (strain 2308)
B2SB45 9.91e-06 47 25 3 118 3 divK Polar-differentiation response regulator DivK Brucella abortus (strain S19)
P23890 1.02e-05 49 28 2 98 1 cadC Transcriptional activator CadC Escherichia coli (strain K12)
P37599 1.04e-05 48 29 5 127 1 cheV Chemotaxis protein CheV Bacillus subtilis (strain 168)
P58253 1.08e-05 48 29 2 96 3 spo0A Stage 0 sporulation protein A homolog Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
P52936 1.17e-05 48 26 4 124 3 spo0A Stage 0 sporulation protein A homolog Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
Q9AAK0 1.17e-05 48 34 3 108 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q5N6V8 1.21e-05 49 24 3 131 3 RR26 Two-component response regulator ORR26 Oryza sativa subsp. japonica
O29221 1.27e-05 48 28 4 122 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
A2XYV5 1.34e-05 47 23 3 121 2 RR6 Two-component response regulator ORR6 Oryza sativa subsp. indica
Q1IRH0 1.43e-05 48 28 4 133 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Koribacter versatilis (strain Ellin345)
P0A4I4 1.48e-05 48 28 1 94 3 spo0A Stage 0 sporulation protein A Bacillus thuringiensis
P0A4I3 1.48e-05 48 28 1 94 3 spo0A Stage 0 sporulation protein A Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
P62598 1.49e-05 48 27 2 110 2 ARR12 Two-component response regulator ARR12 Arabidopsis thaliana
Q7XQA6 1.5e-05 47 23 3 121 2 RR6 Two-component response regulator ORR6 Oryza sativa subsp. japonica
Q75KW7 1.58e-05 46 27 2 112 3 RR41 Two-component response regulator ORR41 Oryza sativa subsp. japonica
Q9SXL4 1.94e-05 48 33 2 80 1 AHK1 Histidine kinase 1 Arabidopsis thaliana
Q2ILG8 1.99e-05 48 30 3 108 3 cheB6 Protein-glutamate methylesterase/protein-glutamine glutaminase 6 Anaeromyxobacter dehalogenans (strain 2CP-C)
P9WGM3 2.07e-05 47 28 2 124 1 pdtaR Transcriptional regulatory protein PdtaR Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM2 2.07e-05 47 28 2 124 3 pdtaR Transcriptional regulatory protein PdtaR Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q8EQQ3 2.25e-05 47 28 2 121 3 lytT Sensory transduction protein LytT Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q9F8D7 2.77e-05 48 26 2 112 3 gacS Sensor histidine kinase GacS Pseudomonas protegens (strain DSM 19095 / LMG 27888 / CFBP 6595 / CHA0)
P52929 3.34e-05 47 30 1 78 3 spo0A Stage 0 sporulation protein A (Fragment) Brevibacillus parabrevis
P0C0F6 3.49e-05 47 33 4 114 1 rpfC Sensory/regulatory protein RpfC Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q23917 4.3e-05 47 23 4 142 1 regA 3',5'-cyclic-nucleotide phosphodiesterase regA Dictyostelium discoideum
P0DMC5 4.52e-05 47 23 0 102 1 rcsC Sensor histidine kinase RcsC Escherichia coli (strain K12)
O83639 4.58e-05 47 29 4 126 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Treponema pallidum (strain Nichols)
P96686 4.78e-05 46 23 3 161 3 ydfI Transcriptional regulatory protein YdfI Bacillus subtilis (strain 168)
P0C0F7 5.37e-05 47 33 4 114 1 rpfC Sensory/regulatory protein RpfC Xanthomonas campestris pv. campestris (strain 8004)
O78417 5.51e-05 46 26 5 156 3 ycf29 Probable transcriptional regulator ycf29 Guillardia theta
Q8ZBV2 5.78e-05 46 30 5 121 3 YPO3287 Uncharacterized response regulatory protein YPO3287/y0902/YP_0397 Yersinia pestis
Q9FGT7 5.97e-05 47 35 1 64 2 ARR18 Two-component response regulator ARR18 Arabidopsis thaliana
Q9K998 6.36e-05 46 31 2 112 3 dctR Probable C4-dicarboxylate response regulator DctR Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
P0AFU5 6.77e-05 46 25 0 100 1 qseF Transcriptional regulatory protein QseF Escherichia coli O157:H7
P0AFU4 6.77e-05 46 25 0 100 1 glrR Transcriptional regulatory protein GlrR Escherichia coli (strain K12)
Q56128 6.89e-05 47 23 0 102 3 rcsC Sensor histidine kinase RcsC Salmonella typhi
P58662 6.95e-05 47 23 0 102 3 rcsC Sensor histidine kinase RcsC Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q87GU5 7.03e-05 47 30 1 103 3 luxQ Autoinducer 2 sensor kinase/phosphatase LuxQ Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q9KU36 7.2e-05 46 31 4 118 3 VC_0693 Uncharacterized response regulatory protein VC_0693 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q6H468 7.27e-05 45 26 2 103 2 RR11 Two-component response regulator ORR11 Oryza sativa subsp. japonica
B8AFR8 7.27e-05 45 26 2 103 3 RR11 Two-component response regulator ORR11 Oryza sativa subsp. indica
P10958 8.18e-05 45 25 0 101 1 fixJ Transcriptional regulatory protein FixJ Rhizobium meliloti (strain 1021)
P52928 9.3e-05 45 27 1 94 3 spo0A Stage 0 sporulation protein A Bacillus anthracis
P70955 9.34e-05 45 26 1 95 1 natR Transcriptional regulatory protein NatR Bacillus subtilis (strain 168)
P06184 9.42e-05 46 26 1 101 3 pgtA Phosphoglycerate transport system transcriptional regulatory protein PgtA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0DMC6 9.67e-05 46 23 0 102 1 rcsC Sensor histidine kinase RcsC Escherichia coli
Q6GK51 9.9e-05 45 32 2 106 3 lytR Transcriptional regulatory protein LytR Staphylococcus aureus (strain MRSA252)
P60610 0.000101 45 32 2 106 3 lytR Transcriptional regulatory protein LytR Staphylococcus aureus (strain N315)
P60609 0.000101 45 32 2 106 1 lytR Transcriptional regulatory protein LytR Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HJB5 0.000101 45 32 2 106 3 lytR Transcriptional regulatory protein LytR Staphylococcus aureus (strain COL)
P60611 0.000101 45 32 2 106 1 lytR Transcriptional regulatory protein LytR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FK09 0.000101 45 32 2 106 3 lytR Transcriptional regulatory protein LytR Staphylococcus aureus (strain USA300)
Q8NYH3 0.000103 45 32 2 106 3 lytR Transcriptional regulatory protein LytR Staphylococcus aureus (strain MW2)
Q6GCL1 0.000103 45 32 2 106 3 lytR Transcriptional regulatory protein LytR Staphylococcus aureus (strain MSSA476)
Q2YV67 0.000103 45 32 2 106 3 lytR Transcriptional regulatory protein LytR Staphylococcus aureus (strain bovine RF122 / ET3-1)
P45709 0.000103 43 25 1 116 3 ccdB Protein CcdB Bacillus subtilis (strain 168)
Q4A010 0.000104 45 26 5 152 3 lytR Sensory transduction protein LytR Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
O80365 0.000114 45 27 4 118 1 ARR8 Two-component response regulator ARR8 Arabidopsis thaliana
Q6K9T0 0.000129 43 25 2 103 2 RR3 Two-component response regulator ORR3 Oryza sativa subsp. japonica
Q4GZK8 0.000129 43 25 2 103 2 RR3 Two-component response regulator ORR3 Oryza sativa subsp. indica
P96602 0.000137 45 31 3 119 3 dctR Probable C4-dicarboxylate response regulator DctR Bacillus subtilis (strain 168)
Q2HWH1 0.000145 43 25 3 116 2 RR5 Two-component response regulator ORR5 Oryza sativa subsp. japonica
Q4GZK6 0.000145 43 25 3 116 2 RR5 Two-component response regulator ORR5 Oryza sativa subsp. indica
Q9RC52 0.000155 45 26 1 105 3 citT Transcriptional regulatory protein CitT Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
P42012 0.000174 45 25 2 104 3 spo0A Stage 0 sporulation protein A Lysinibacillus sphaericus
O31517 0.000207 45 19 0 91 3 yesN Uncharacterized transcriptional regulatory protein YesN Bacillus subtilis (strain 168)
Q2RRX2 0.000226 45 32 3 104 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
O82798 0.000332 44 29 2 75 1 ARR4 Two-component response regulator ARR4 Arabidopsis thaliana
Q2RZD2 0.000343 44 27 3 128 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Salinibacter ruber (strain DSM 13855 / M31)
Q3ADA6 0.000397 44 30 4 110 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
P59342 0.000423 44 28 2 106 3 barA Signal transduction histidine-protein kinase BarA Shigella flexneri
P0AEC5 0.000476 44 28 2 106 1 barA Signal transduction histidine-protein kinase BarA Escherichia coli (strain K12)
P0AEC6 0.000476 44 28 2 106 1 barA Signal transduction histidine-protein kinase BarA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AEC7 0.000476 44 28 2 106 3 barA Signal transduction histidine-protein kinase BarA Escherichia coli O157:H7
O87940 0.000536 43 27 0 76 1 tdiR Transcriptional regulatory protein TdiR Thauera aromatica
Q10N34 0.000549 44 24 2 122 2 PRR73 Two-component response regulator-like PRR73 Oryza sativa subsp. japonica
A2XFB7 0.000549 44 24 2 122 2 PRR73 Two-component response regulator-like PRR73 Oryza sativa subsp. indica
P0A4H2 0.000553 43 26 2 134 1 bvgA Virulence factors putative positive transcription regulator BvgA Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
P0A4H4 0.000553 43 26 2 134 3 bvgA Virulence factors putative positive transcription regulator BvgA Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
P0A4H3 0.000553 43 26 2 134 3 bvgA Virulence factors putative positive transcription regulator BvgA Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q551X9 0.000575 44 24 2 121 3 dhkF Hybrid signal transduction histidine kinase F Dictyostelium discoideum
Q9P4U6 0.000627 44 31 1 83 1 tcsB Two-component system protein B Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
P52932 0.000662 43 25 3 119 3 spo0A Stage 0 sporulation protein A (Fragment) Priestia megaterium
G0SB31 0.000701 43 25 1 104 1 SKN7 Transcription factor SKN7 Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS03915
Feature type CDS
Gene -
Product copper/silver response regulator transcription factor
Location 829720 - 830406 (strand: -1)
Length 687 (nucleotides) / 228 (amino acids)

Contig

Accession term accessions NZ_VXKB01000001 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_241
Orthogroup size 8
N. genomes 6

Actions

Genomic region

Domains

PF00072 Response regulator receiver domain
PF00486 Transcriptional regulatory protein, C terminal

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0745 Signal transduction mechanisms (T)
Transcription (K)
TK DNA-binding response regulator, OmpR family, contains REC and winged-helix (wHTH) domain

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K07665 two-component system, OmpR family, copper resistance phosphate regulon response regulator CusR Two-component system Imipenem resistance, repression of porin OprD

Protein Sequence

MKILIIEDESKTGEYLKKGLSEAGFIVDLTDNGLTGYHLALTADYDLIVLDIMLPDVNGWEIIRMLRAANKGMPVLLLSALGTIEHRVKGLELGADDYLVKPFAFAELLARVRTLLRRGTAIIAESEFRIADLMMDRASRKVTRSGERITLTSKEFSLLEFFLRHQGEVLPRALIASQVWDMNFDSDTNVIDVAVKRLRAKIDQDFEPKLIHTIRSVGYVLEIPDDKK

Flanking regions ( +/- flanking 50bp)

TGATTTTGCGCATTAAAATGGCTGATGTACTTCACTGAACAGGAACAAGTGTGAAAATTTTAATCATTGAAGATGAAAGCAAAACAGGCGAATACCTGAAAAAAGGATTATCAGAGGCCGGTTTTATTGTCGATCTGACCGATAATGGTCTGACCGGGTATCATCTGGCGCTGACGGCTGATTATGACCTGATTGTGCTGGATATTATGCTGCCGGATGTCAACGGCTGGGAAATTATCCGTATGCTCAGAGCCGCAAATAAAGGTATGCCGGTGTTACTGCTCTCCGCACTCGGTACTATTGAGCACCGCGTCAAAGGTCTTGAGCTGGGTGCGGATGACTATCTGGTCAAGCCCTTTGCATTTGCCGAGTTACTGGCGCGGGTCAGAACCCTGCTGCGCCGGGGAACTGCGATTATTGCCGAAAGCGAATTCCGGATCGCTGACCTGATGATGGATCGCGCGTCACGCAAAGTGACCCGCAGCGGTGAACGCATCACGCTGACGAGTAAAGAATTTTCACTGCTGGAATTTTTTCTGCGCCACCAGGGTGAAGTGCTGCCGCGTGCACTTATCGCCTCACAGGTCTGGGATATGAATTTTGACAGTGATACCAATGTGATTGATGTGGCAGTCAAACGCCTGCGCGCCAAAATTGATCAGGATTTTGAGCCGAAACTGATCCATACCATCCGCAGTGTCGGTTATGTCCTTGAGATCCCCGATGATAAAAAATAAGCCCTGCCGCCCCTTTTCCCTTGCCACCCGGCTGACCTTTTTTATCAGCC