Homologs in group_241

Help

7 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_02140 FBDBKF_02140 100.0 Morganella morganii S1 ompR DNA-binding response regulator, OmpR family, contains REC and winged-helix (wHTH) domain
EHELCC_02610 EHELCC_02610 100.0 Morganella morganii S2 ompR DNA-binding response regulator, OmpR family, contains REC and winged-helix (wHTH) domain
NLDBIP_00850 NLDBIP_00850 100.0 Morganella morganii S4 ompR DNA-binding response regulator, OmpR family, contains REC and winged-helix (wHTH) domain
LHKJJB_01185 LHKJJB_01185 100.0 Morganella morganii S3 ompR DNA-binding response regulator, OmpR family, contains REC and winged-helix (wHTH) domain
F4V73_RS03915 F4V73_RS03915 56.8 Morganella psychrotolerans - copper/silver response regulator transcription factor
F4V73_RS04490 F4V73_RS04490 87.4 Morganella psychrotolerans hprR response regulator transcription factor HprR
F4V73_RS10180 F4V73_RS10180 30.0 Morganella psychrotolerans - response regulator transcription factor

Distribution of the homologs in the orthogroup group_241

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_241

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P76340 2.31e-99 290 62 0 216 1 hprR Transcriptional regulatory protein HprR Escherichia coli (strain K12)
Q44006 9.83e-83 248 55 1 220 2 czcR Transcriptional activator protein CzcR Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
P0ACZ8 1.01e-81 246 54 3 223 1 cusR Transcriptional regulatory protein CusR Escherichia coli (strain K12)
P0ACZ9 1.01e-81 246 54 3 223 3 cusR Transcriptional regulatory protein CusR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AD00 1.01e-81 246 54 3 223 3 cusR Transcriptional regulatory protein CusR Escherichia coli O157:H7
P0DMK7 3.91e-80 242 57 1 220 3 irlR Transcriptional activator protein IrlR Burkholderia pseudomallei (strain K96243)
I1WSZ4 3.91e-80 242 57 1 220 3 irlR Transcriptional activator protein IrlR Burkholderia pseudomallei (strain 1026b)
Q02540 1.46e-77 235 53 2 225 1 copR Transcriptional activator protein CopR Pseudomonas syringae pv. tomato
Q47456 4.53e-76 231 53 2 219 3 pcoR Transcriptional regulatory protein PcoR Escherichia coli
Q9ZHD3 1.39e-73 225 54 4 223 3 silR Probable transcriptional regulatory protein SilR Salmonella typhimurium
O34903 2.04e-59 189 44 3 225 3 ykoG Uncharacterized transcriptional regulatory protein YkoG Bacillus subtilis (strain 168)
P0C001 2.34e-52 171 40 1 215 3 arlR Response regulator ArlR Staphylococcus aureus (strain MW2)
Q6G9E6 2.34e-52 171 40 1 215 3 arlR Response regulator ArlR Staphylococcus aureus (strain MSSA476)
Q6GGZ3 2.34e-52 171 40 1 215 3 arlR Response regulator ArlR Staphylococcus aureus (strain MRSA252)
P0C000 2.34e-52 171 40 1 215 3 arlR Response regulator ArlR Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HG04 2.34e-52 171 40 1 215 3 arlR Response regulator ArlR Staphylococcus aureus (strain COL)
Q2YY03 2.34e-52 171 40 1 215 3 arlR Response regulator ArlR Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q9KJN4 2.34e-52 171 40 1 215 1 arlR Response regulator ArlR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FH23 2.34e-52 171 40 1 215 3 arlR Response regulator ArlR Staphylococcus aureus (strain USA300)
Q4L6C6 4.53e-52 170 41 1 215 3 arlR Response regulator ArlR Staphylococcus haemolyticus (strain JCSC1435)
A1TEL7 4.07e-50 166 41 2 224 3 mprA Response regulator MprA Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
Q49XM7 5.89e-50 165 42 1 215 3 arlR Response regulator ArlR Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q742C1 7.25e-49 162 39 2 221 3 mprA Response regulator MprA Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
A0QBQ9 7.25e-49 162 39 2 221 3 mprA Response regulator MprA Mycobacterium avium (strain 104)
Q99U73 8.36e-49 162 40 2 215 3 arlR Response regulator ArlR Staphylococcus aureus (strain N315)
Q9CD68 1.43e-48 161 39 2 223 3 mprA Response regulator MprA Mycobacterium leprae (strain TN)
A1KHB7 1.54e-48 161 39 2 221 3 mprA Response regulator MprA Mycobacterium bovis (strain BCG / Pasteur 1173P2)
Q7U0X4 1.54e-48 161 39 2 221 1 mprA Response regulator MprA Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q1B3X8 1.85e-48 161 39 2 223 3 mprA Response regulator MprA Mycobacterium sp. (strain MCS)
A1UL70 1.85e-48 161 39 2 223 3 mprA Response regulator MprA Mycobacterium sp. (strain KMS)
A3Q5L9 1.85e-48 161 39 2 223 3 mprA Response regulator MprA Mycobacterium sp. (strain JLS)
P9WGM9 1.93e-48 161 39 2 221 1 mprA Response regulator MprA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM8 1.93e-48 161 39 2 221 3 mprA Response regulator MprA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5U123 1.93e-48 161 39 2 221 3 mprA Response regulator MprA Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
L7N689 7.2e-48 160 40 3 227 1 trcR Transcriptional regulatory protein TrcR Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
A0R3I8 9.37e-48 159 39 2 223 1 mprA Response regulator MprA Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
A0PWB4 1.28e-46 157 38 2 225 3 mprA Response regulator MprA Mycobacterium ulcerans (strain Agy99)
Q8CQK0 1.65e-46 156 39 3 227 3 walR Transcriptional regulatory protein WalR Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HK18 1.65e-46 156 39 3 227 3 walR Transcriptional regulatory protein WalR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q7D9K0 2.35e-46 157 40 2 221 3 tcrA Transcriptional regulatory protein TcrA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
O07776 2.35e-46 157 40 2 221 1 tcrA Transcriptional regulatory protein TcrA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Q4LAJ9 3.02e-46 155 39 3 227 3 walR Transcriptional regulatory protein WalR Staphylococcus haemolyticus (strain JCSC1435)
Q4A160 3.71e-46 155 39 3 230 3 walR Transcriptional regulatory protein WalR Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q7A216 3.87e-46 155 39 3 230 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain MW2)
Q9RDT5 3.87e-46 155 39 3 230 1 walR Transcriptional regulatory protein WalR Staphylococcus aureus
A8YYU1 3.87e-46 155 39 3 230 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain USA300 / TCH1516)
Q6GD72 3.87e-46 155 39 3 230 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain MSSA476)
Q6GKS7 3.87e-46 155 39 3 230 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain MRSA252)
Q7A8E1 3.87e-46 155 39 3 230 1 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain N315)
Q99XF3 3.87e-46 155 39 3 230 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QD57 3.87e-46 155 39 3 230 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain Newman)
Q5HJX7 3.87e-46 155 39 3 230 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain COL)
Q2YUQ3 3.87e-46 155 39 3 230 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain bovine RF122 / ET3-1)
A5INQ9 3.87e-46 155 39 3 230 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain JH9)
Q2G2U6 3.87e-46 155 39 3 230 1 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FKN8 3.87e-46 155 39 3 230 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain USA300)
A6TXG8 3.87e-46 155 39 3 230 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain JH1)
A7WWQ5 3.87e-46 155 39 3 230 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain Mu3 / ATCC 700698)
P13792 5.54e-46 155 40 4 230 1 phoP Alkaline phosphatase synthesis transcriptional regulatory protein PhoP Bacillus subtilis (strain 168)
Q5HPC3 4.86e-45 152 40 1 215 3 arlR Response regulator ArlR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q8CP82 8.72e-45 152 40 1 215 3 arlR Response regulator ArlR Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q8DPL7 8.75e-45 152 38 2 231 1 walR Transcriptional regulatory protein WalR Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
A0A0H2UQ68 8.75e-45 152 38 2 231 1 walR Transcriptional regulatory protein WalR Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
A0A0H2ZN37 8.75e-45 152 38 2 231 1 walR Transcriptional regulatory protein WalR Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
P9WGM1 8.98e-45 152 40 2 210 1 prrA Transcriptional regulatory protein PrrA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM0 8.98e-45 152 40 2 210 3 prrA Transcriptional regulatory protein PrrA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0A5Z7 8.98e-45 152 40 2 210 3 prrA Transcriptional regulatory protein PrrA Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q9F868 1.07e-44 152 39 2 226 1 regX3 Sensory transduction protein RegX3 Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
P42244 1.5e-44 151 38 3 223 3 ycbL Uncharacterized transcriptional regulatory protein YcbL Bacillus subtilis (strain 168)
Q50136 2.88e-44 150 40 2 210 3 prrA Transcriptional regulatory protein PrrA Mycobacterium leprae (strain TN)
P9WGL9 3.16e-44 150 40 2 225 1 regX3 Sensory transduction protein RegX3 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGL8 3.16e-44 150 40 2 225 2 regX3 Sensory transduction protein RegX3 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
O07130 3.16e-44 150 40 2 225 1 regX3 Sensory transduction protein RegX3 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q7A0U4 4.28e-44 150 37 2 228 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain MW2)
Q9L524 4.28e-44 150 37 2 228 2 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus
Q6G972 4.28e-44 150 37 2 228 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain MSSA476)
Q6GGK6 4.28e-44 150 37 2 228 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain MRSA252)
Q7A5H6 4.28e-44 150 37 2 228 1 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain N315)
Q7A2R6 4.28e-44 150 37 2 228 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HFT0 4.28e-44 150 37 2 228 2 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain COL)
Q2FY79 4.28e-44 150 37 2 228 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain NCTC 8325 / PS 47)
P28835 4.35e-44 150 41 4 234 3 ycf27 Probable transcriptional regulator ycf27 Porphyridium aerugineum
P35163 9.46e-44 149 37 3 233 1 resD Transcriptional regulatory protein ResD Bacillus subtilis (strain 168)
P37478 4.63e-43 147 38 2 230 1 walR Transcriptional regulatory protein WalR Bacillus subtilis (strain 168)
P28257 8.51e-42 145 41 3 226 3 ycf27 Probable transcriptional regulator ycf27 Galdieria sulphuraria
P45605 1.81e-41 143 37 4 225 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Klebsiella pneumoniae
Q9I0I1 3.15e-41 142 38 3 223 1 carR Response regulator protein CarR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P45606 5.03e-41 142 37 4 224 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Shigella dysenteriae
P0AFJ5 5.31e-41 142 37 4 224 1 phoB Phosphate regulon transcriptional regulatory protein PhoB Escherichia coli (strain K12)
P0AFJ6 5.31e-41 142 37 4 224 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Escherichia coli O157:H7
P94413 6.1e-41 142 35 3 226 3 yclJ Uncharacterized transcriptional regulatory protein YclJ Bacillus subtilis (strain 168)
P54884 6.55e-41 141 44 2 178 3 rgx3 Sensory transduction protein RegX3 Mycobacterium leprae (strain TN)
P45337 1.44e-40 141 39 3 224 3 qseB Transcriptional regulatory protein QseB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P32040 1.51e-40 142 38 4 231 3 SYNPCC7002_A0851 Probable transcriptional regulatory protein SYNPCC7002_A0851 Picosynechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)
P51358 2.82e-40 140 38 3 226 3 ycf27 Probable transcriptional regulator ycf27 Porphyra purpurea
Q1XDC9 3.43e-40 140 38 3 226 3 ycf27 Probable transcriptional regulator ycf27 Neopyropia yezoensis
P48259 3.66e-40 140 39 3 226 3 ycf27 Probable transcriptional regulator ycf27 Cyanophora paradoxa
Q8XBS3 4.14e-40 139 39 3 221 2 qseB Transcriptional regulatory protein QseB Escherichia coli O157:H7
P45607 1.02e-39 139 37 4 224 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Shigella flexneri
O78428 1.05e-39 139 39 3 226 3 ycf27 Probable transcriptional regulator ycf27 Guillardia theta
P52076 1.58e-39 138 39 3 221 2 qseB Transcriptional regulatory protein QseB Escherichia coli (strain K12)
Q47744 5.59e-39 137 34 1 221 3 vanRB Regulatory protein VanRB Enterococcus faecalis (strain ATCC 700802 / V583)
P0A4I0 6.11e-39 137 35 3 222 3 dltR Transcriptional regulatory protein DltR Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
P0A4H9 6.11e-39 137 35 3 222 3 dltR Transcriptional regulatory protein DltR Streptococcus agalactiae serotype III (strain NEM316)
P0CL17 6.87e-39 137 40 5 222 2 tctD Transcriptional regulatory protein TctD Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
E1WA34 6.87e-39 137 40 5 222 3 tctD Transcriptional regulatory protein TctD Salmonella typhimurium (strain SL1344)
P66795 6.9e-39 136 38 3 221 3 qseB Transcriptional regulatory protein QseB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P66796 6.9e-39 136 38 3 221 3 qseB Transcriptional regulatory protein QseB Salmonella typhi
Q93CB8 1.02e-38 136 39 3 219 3 mtrA DNA-binding response regulator MtrA Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
P9WGM7 1.2e-38 136 39 3 219 1 mtrA DNA-binding response regulator MtrA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM6 1.2e-38 136 39 3 219 3 mtrA DNA-binding response regulator MtrA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0A5Z5 1.2e-38 136 39 3 219 3 mtrA DNA-binding response regulator MtrA Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q9CCJ2 2.28e-38 135 39 3 219 3 mtrA DNA-binding response regulator MtrA Mycobacterium leprae (strain TN)
A0QTK2 3.27e-38 135 39 3 219 1 mtrA DNA-binding response regulator MtrA Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q9I4F9 3.63e-38 135 36 2 218 1 phoP Two-component response regulator PhoP Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P39663 4.73e-38 135 37 5 232 1 sphR Alkaline phosphatase synthesis transcriptional regulatory protein SphR Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q82EB1 6.26e-38 134 37 2 232 3 cseB Transcriptional regulatory protein CseB Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q52990 6.77e-38 134 37 2 224 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Rhizobium meliloti (strain 1021)
Q8CN92 9.4e-38 134 32 1 220 3 hssR Heme response regulator HssR Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HLN2 1.23e-37 133 32 1 220 3 hssR Heme response regulator HssR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q9TLQ4 4.8e-37 132 35 3 229 3 ycf27 Probable transcriptional regulator ycf27 Cyanidium caldarium
O69730 8.38e-37 131 36 3 223 1 tcrX Probable transcriptional regulatory protein TcrX Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Q9ZEP4 2.51e-36 130 36 2 231 1 cseB Transcriptional regulatory protein CseB Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q4L8L9 7.79e-36 129 31 1 219 3 hssR Heme response regulator HssR Staphylococcus haemolyticus (strain JCSC1435)
Q8FZ93 1.56e-35 128 35 3 221 1 ctrA Cell cycle response regulator CtrA Brucella suis biovar 1 (strain 1330)
B0CI76 1.56e-35 128 35 3 221 3 ctrA Cell cycle response regulator CtrA Brucella suis (strain ATCC 23445 / NCTC 10510)
A5VRW9 1.56e-35 128 35 3 221 1 ctrA Cell cycle response regulator CtrA Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q7CNV1 1.56e-35 128 35 3 221 1 ctrA Cell cycle response regulator CtrA Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
A9M708 1.56e-35 128 35 3 221 3 ctrA Cell cycle response regulator CtrA Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q9ZHS1 1.56e-35 128 35 3 221 1 ctrA Cell cycle response regulator CtrA Brucella abortus biovar 1 (strain 9-941)
Q2YQA4 1.56e-35 128 35 3 221 1 ctrA Cell cycle response regulator CtrA Brucella abortus (strain 2308)
B2S753 1.56e-35 128 35 3 221 3 ctrA Cell cycle response regulator CtrA Brucella abortus (strain S19)
Q49ZT8 3.05e-35 127 30 1 217 3 hssR Heme response regulator HssR Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q9HV32 3.34e-35 127 37 3 218 1 pmrA Response regulator protein PmrA Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P36556 3.74e-35 127 33 3 224 1 basR Transcriptional regulatory protein BasR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
A6WZ81 3.83e-35 127 35 3 221 3 ctrA Cell cycle response regulator CtrA Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
P0A4H8 4.16e-35 127 33 3 220 3 ciaR Transcriptional regulatory protein CiaR Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P0A4H7 4.16e-35 127 33 3 220 3 ciaR Transcriptional regulatory protein CiaR Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q04942 6.77e-35 126 38 2 223 1 afsQ1 Transcriptional regulatory protein AfsQ1 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
P31079 8.64e-35 126 35 4 227 3 petR Protein PetR Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
Q55933 2.19e-34 125 34 6 236 1 rppA Response regulator RppA Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q2YZ24 2.22e-34 125 30 1 219 3 hssR Heme response regulator HssR Staphylococcus aureus (strain bovine RF122 / ET3-1)
P23620 3.51e-34 124 33 3 222 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P30843 3.6e-34 124 35 4 225 1 basR Transcriptional regulatory protein BasR Escherichia coli (strain K12)
Q7A039 4.26e-34 124 30 1 219 3 hssR Heme response regulator HssR Staphylococcus aureus (strain MW2)
A8Z552 4.26e-34 124 30 1 219 3 hssR Heme response regulator HssR Staphylococcus aureus (strain USA300 / TCH1516)
Q6G6V9 4.26e-34 124 30 1 219 3 hssR Heme response regulator HssR Staphylococcus aureus (strain MSSA476)
Q7A3X1 4.26e-34 124 30 1 219 3 hssR Heme response regulator HssR Staphylococcus aureus (strain N315)
Q99RR6 4.26e-34 124 30 1 219 3 hssR Heme response regulator HssR Staphylococcus aureus (strain Mu50 / ATCC 700699)
A5IVE2 4.26e-34 124 30 1 219 3 hssR Heme response regulator HssR Staphylococcus aureus (strain JH9)
Q2FVQ9 4.26e-34 124 30 1 219 3 hssR Heme response regulator HssR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FED5 4.26e-34 124 30 1 219 3 hssR Heme response regulator HssR Staphylococcus aureus (strain USA300)
A6U488 4.26e-34 124 30 1 219 3 hssR Heme response regulator HssR Staphylococcus aureus (strain JH1)
A7X5Y5 4.26e-34 124 30 1 219 3 hssR Heme response regulator HssR Staphylococcus aureus (strain Mu3 / ATCC 700698)
P94504 4.54e-34 124 32 4 224 3 yvrH Transcriptional regulatory protein YvrH Bacillus subtilis (strain 168)
Q6GE73 4.9e-34 124 30 1 219 3 hssR Heme response regulator HssR Staphylococcus aureus (strain MRSA252)
G3XCY6 9.36e-34 124 38 4 226 1 gltR Transcriptional regulatory protein GltR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
A6QJK3 1.17e-33 123 30 1 219 1 hssR Heme response regulator HssR Staphylococcus aureus (strain Newman)
Q5HDJ4 1.17e-33 123 30 1 219 3 hssR Heme response regulator HssR Staphylococcus aureus (strain COL)
B8H358 1.32e-33 123 34 3 221 3 ctrA Cell cycle transcriptional regulator CtrA Caulobacter vibrioides (strain NA1000 / CB15N)
P0CAW8 1.32e-33 123 34 3 221 3 ctrA Cell cycle transcriptional regulator CtrA Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
P0A4I2 1.43e-33 122 36 3 220 3 cutR Transcriptional regulatory protein CutR Streptomyces lividans
P0A4I1 1.43e-33 122 36 3 220 3 cutR Transcriptional regulatory protein CutR Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q9AE24 2.38e-33 122 32 3 223 3 rprY Transcriptional regulatory protein RprY Bacteroides fragilis (strain YCH46)
P9WGN1 3.26e-33 122 34 3 224 1 kdpE Transcriptional regulatory protein KdpE Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGN0 3.26e-33 122 34 3 224 3 kdpE Transcriptional regulatory protein KdpE Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q06239 6.51e-33 121 32 3 226 3 vanR Regulatory protein VanR Enterococcus faecium
O32192 2.97e-32 119 37 5 226 1 cssR Transcriptional regulatory protein CssR Bacillus subtilis (strain 168)
Q70FH0 4.01e-32 119 34 3 224 3 pmrA Transcriptional regulatory protein PmrA Pectobacterium parmentieri
Q9KM23 7.28e-32 119 37 5 224 1 vxrB Transcriptional regulatory protein VxrB Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q55890 1.76e-31 118 35 6 231 1 rpaA DNA-binding dual master transcriptional regulator RpaA Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P54443 1.77e-31 117 35 4 229 3 yrkP Uncharacterized transcriptional regulatory protein YrkP Bacillus subtilis (strain 168)
A0A0H3GGB5 4.08e-31 117 35 3 225 2 cpxR Transcriptional regulatory protein CpxR Klebsiella pneumoniae subsp. pneumoniae (strain HS11286)
P0AE90 7.58e-31 116 36 3 225 3 cpxR Transcriptional regulatory protein CpxR Shigella flexneri
P0AE88 7.58e-31 116 36 3 225 1 cpxR Transcriptional regulatory protein CpxR Escherichia coli (strain K12)
P0AE89 7.58e-31 116 36 3 225 3 cpxR Transcriptional regulatory protein CpxR Escherichia coli O157:H7
P45189 1.46e-30 115 32 3 223 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P38684 1.54e-30 115 34 6 226 1 torR TorCAD operon transcriptional regulatory protein TorR Escherichia coli (strain K12)
P58357 2.19e-30 115 34 6 226 3 torR TorCAD operon transcriptional regulatory protein TorR Escherichia coli O157:H7
Q57QC3 2.32e-30 114 32 2 218 3 phoP Virulence transcriptional regulatory protein PhoP Salmonella choleraesuis (strain SC-B67)
A0A4P7TS68 5.09e-30 114 32 5 226 1 ompR DNA-binding dual transcriptional regulator OmpR Shigella flexneri serotype 5a (strain M90T)
P0AA21 5.09e-30 114 32 5 226 3 ompR DNA-binding dual transcriptional regulator OmpR Shigella flexneri
P0AA19 5.09e-30 114 32 5 226 3 ompR DNA-binding dual transcriptional regulator OmpR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
A0A0H3NGY1 5.09e-30 114 32 5 226 3 ompR DNA-binding dual transcriptional regulator OmpR Salmonella typhimurium (strain SL1344)
P0AA20 5.09e-30 114 32 5 226 1 ompR DNA-binding dual transcriptional regulator OmpR Salmonella typhi
P0AA16 5.09e-30 114 32 5 226 1 ompR DNA-binding dual transcriptional regulator OmpR Escherichia coli (strain K12)
P0AA17 5.09e-30 114 32 5 226 3 ompR DNA-binding dual transcriptional regulator OmpR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AA18 5.09e-30 114 32 5 226 3 ompR DNA-binding dual transcriptional regulator OmpR Escherichia coli O157:H7
Q8Z7H2 9.17e-30 113 31 2 218 3 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhi
P44918 9.57e-30 113 31 3 229 3 arcA Aerobic respiration control protein ArcA homolog Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q7A1J1 1.15e-29 113 29 5 226 3 saeR Response regulator SaeR Staphylococcus aureus (strain MW2)
Q6GBC4 1.15e-29 113 29 5 226 3 saeR Response regulator SaeR Staphylococcus aureus (strain MSSA476)
Q6GIT6 1.15e-29 113 29 5 226 3 saeR Response regulator SaeR Staphylococcus aureus (strain MRSA252)
Q7A6V3 1.15e-29 113 29 5 226 1 saeR Response regulator SaeR Staphylococcus aureus (strain N315)
Q99VR7 1.15e-29 113 29 5 226 3 saeR Response regulator SaeR Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q840P8 1.15e-29 113 29 5 226 1 saeR Response regulator SaeR Staphylococcus aureus (strain Newman)
Q5HHW4 1.15e-29 113 29 5 226 1 saeR Response regulator SaeR Staphylococcus aureus (strain COL)
Q2YSM5 1.15e-29 113 29 5 226 3 saeR Response regulator SaeR Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q2G2G2 1.15e-29 113 29 5 226 1 saeR Response regulator SaeR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FIT4 1.15e-29 113 29 5 226 3 saeR Response regulator SaeR Staphylococcus aureus (strain USA300)
P0DM78 1.56e-29 112 31 2 218 1 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
F5ZP95 1.56e-29 112 31 2 218 1 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhimurium (strain ATCC 68169 / UK-1)
E1WFA1 1.56e-29 112 31 2 218 2 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhimurium (strain SL1344)
D0ZV90 1.56e-29 112 31 2 218 1 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhimurium (strain 14028s / SGSC 2262)
Q5PMJ1 1.56e-29 112 31 2 218 3 phoP Virulence transcriptional regulatory protein PhoP Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q01473 1.91e-29 118 36 6 227 3 rcaC Protein RcaC Microchaete diplosiphon
Q01473 0.001 43 23 1 118 3 rcaC Protein RcaC Microchaete diplosiphon
P42421 1.92e-29 112 30 1 226 3 yxdJ Transcriptional regulatory protein YxdJ Bacillus subtilis (strain 168)
Q31S42 1.21e-28 110 35 8 231 1 rpaA DNA-binding dual master transcriptional regulator RpaA Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
P23836 1.37e-28 110 30 2 218 1 phoP Transcriptional regulatory protein PhoP Escherichia coli (strain K12)
Q83RR0 1.62e-28 110 30 2 218 3 phoP Virulence transcriptional regulatory protein PhoP Shigella flexneri
Q8CXZ9 1.62e-28 110 30 2 218 3 phoP Transcriptional regulatory protein PhoP Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P21866 3.09e-28 109 31 3 222 1 kdpE KDP operon transcriptional regulatory protein KdpE Escherichia coli (strain K12)
Q8CQ17 4.87e-28 108 30 6 227 1 saeR Response regulator SaeR Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HR28 4.87e-28 108 30 6 227 3 saeR Response regulator SaeR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q8X738 7.91e-28 108 30 2 218 3 phoP Transcriptional regulatory protein PhoP Escherichia coli O157:H7
Q44929 2.13e-27 107 31 4 227 3 gtcR Response regulator GtcR Aneurinibacillus migulanus
O06978 5.31e-27 106 30 4 227 3 yvcP Uncharacterized transcriptional regulatory protein YvcP Bacillus subtilis (strain 168)
O24973 1.03e-26 105 34 2 222 1 arsR Transcriptional regulatory protein ArsR Helicobacter pylori (strain ATCC 700392 / 26695)
Q4L481 1.55e-26 105 30 1 220 3 graR Response regulator protein GraR Staphylococcus haemolyticus (strain JCSC1435)
O31432 2.72e-26 104 33 7 221 3 ybdJ Uncharacterized transcriptional regulatory protein YbdJ Bacillus subtilis (strain 168)
Q8GP20 2.75e-26 103 33 5 223 1 rssB Swarming motility regulation protein RssB Serratia marcescens
P0A9Q4 5.68e-26 103 31 3 229 3 arcA Aerobic respiration control protein ArcA Shigella flexneri
P0A9Q1 5.68e-26 103 31 3 229 1 arcA Aerobic respiration control protein ArcA Escherichia coli (strain K12)
P0A9Q2 5.68e-26 103 31 3 229 3 arcA Aerobic respiration control protein ArcA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0A9Q3 5.68e-26 103 31 3 229 3 arcA Aerobic respiration control protein ArcA Escherichia coli O157:H7
Q04803 1.3e-25 104 35 2 225 3 pfeR Transcriptional activator protein PfeR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q07783 1.96e-25 102 30 3 236 3 chvI Transcriptional regulatory protein ChvI Rhizobium radiobacter
A8Z181 2.01e-25 102 31 1 220 3 graR Response regulator protein GraR Staphylococcus aureus (strain USA300 / TCH1516)
A6QEW8 2.01e-25 102 31 1 220 3 graR Response regulator protein GraR Staphylococcus aureus (strain Newman)
Q5HI09 2.01e-25 102 31 1 220 1 graR Response regulator protein GraR Staphylococcus aureus (strain COL)
Q2G0E0 2.01e-25 102 31 1 220 1 graR Response regulator protein GraR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FIY0 2.01e-25 102 31 1 220 3 graR Response regulator protein GraR Staphylococcus aureus (strain USA300)
Q6GJ11 2.19e-25 102 31 1 220 3 graR Response regulator protein GraR Staphylococcus aureus (strain MRSA252)
Q2YSS2 2.49e-25 101 31 1 220 3 graR Response regulator protein GraR Staphylococcus aureus (strain bovine RF122 / ET3-1)
P44895 2.96e-25 101 32 4 224 3 cpxR Transcriptional regulatory protein CpxR homolog Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q7A1L2 3.38e-25 101 31 1 220 3 graR Response regulator protein GraR Staphylococcus aureus (strain MW2)
Q6GBH1 3.38e-25 101 31 1 220 3 graR Response regulator protein GraR Staphylococcus aureus (strain MSSA476)
Q99VW2 3.38e-25 101 31 1 220 3 graR Response regulator protein GraR Staphylococcus aureus (strain N315)
A5IQL2 3.38e-25 101 31 1 220 3 graR Response regulator protein GraR Staphylococcus aureus (strain JH9)
A6TZD6 3.38e-25 101 31 1 220 3 graR Response regulator protein GraR Staphylococcus aureus (strain JH1)
A7WZC3 3.38e-25 101 31 1 220 3 graR Response regulator protein GraR Staphylococcus aureus (strain Mu3 / ATCC 700698)
P50350 3.85e-25 101 31 3 235 3 chvI Transcriptional regulatory protein ChvI Rhizobium meliloti (strain 1021)
Q932F1 4.36e-25 101 31 1 220 1 graR Response regulator protein GraR Staphylococcus aureus (strain Mu50 / ATCC 700699)
P69228 1.41e-24 100 29 4 221 1 baeR Transcriptional regulatory protein BaeR Escherichia coli (strain K12)
P69229 1.41e-24 100 29 4 221 1 baeR Transcriptional regulatory protein BaeR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P08368 3.58e-24 99 33 4 224 1 creB Transcriptional regulatory protein CreB Escherichia coli (strain K12)
Q8CQ37 1.29e-23 97 30 1 220 3 graR Response regulator protein GraR Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HR81 1.29e-23 97 30 1 220 3 graR Response regulator protein GraR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
P50351 1.61e-23 97 30 3 239 3 chvI Transcriptional regulatory protein ChvI Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q49VK3 2.54e-23 96 29 1 224 3 graR Response regulator protein GraR Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
P52108 9.23e-22 92 30 3 228 1 rstA Transcriptional regulatory protein RstA Escherichia coli (strain K12)
Q9HUI2 2.66e-21 91 30 5 230 3 aruR Transcriptional regulatory protein AruR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
O34951 2.94e-21 91 31 4 222 3 bceR Sensory transduction protein BceR Bacillus subtilis (strain 168)
P55701 9.95e-21 89 29 4 220 4 NGR_a00800 Probable transcriptional regulatory protein y4xI Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q8DN02 1.27e-20 89 29 3 221 1 rr06 Response regulator RR06 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
A0A0H2ZNF6 1.27e-20 89 29 3 221 1 rr06 Response regulator RR06 Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q9K621 4.64e-20 88 30 3 221 3 bceR Sensory transduction protein BceR Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q1XDE4 2.2e-19 85 36 3 158 3 ycf29 Probable transcriptional regulator ycf29 Neopyropia yezoensis
P33112 2.3e-19 85 31 4 219 3 spaR Transcriptional regulatory protein SpaR Bacillus subtilis
Q07597 6.96e-19 84 25 2 227 3 nisR Nisin biosynthesis regulatory protein NisR Lactococcus lactis subsp. lactis
Q2FWH6 2.31e-18 83 27 4 223 1 kdpE Transcriptional regulatory protein KdpE Staphylococcus aureus (strain NCTC 8325 / PS 47)
P13359 4.38e-18 83 31 6 224 3 virG Regulatory protein VirG Rhizobium rhizogenes
P07545 1.06e-17 82 36 6 169 3 virG Regulatory protein VirG Agrobacterium fabrum (strain C58 / ATCC 33970)
O25918 4.53e-16 77 29 6 220 3 crdR Transcriptional regulatory protein CrdR Helicobacter pylori (strain ATCC 700392 / 26695)
B8GZM2 6.71e-16 79 36 1 118 1 pleD Response regulator PleD Caulobacter vibrioides (strain NA1000 / CB15N)
Q9A5I5 6.71e-16 79 36 1 118 1 pleD Response regulator PleD Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
P62722 1.33e-15 76 34 6 169 3 virG Regulatory protein VirG Agrobacterium tumefaciens (strain 15955)
Q44444 1.67e-15 76 34 6 169 3 virG Regulatory protein VirG Rhizobium radiobacter
P72781 4.44e-15 74 36 2 126 1 rre1 Response regulator Rre1 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P46384 8.18e-15 71 29 1 127 1 pilG Protein PilG Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q05943 1.41e-13 71 35 2 130 3 glnR Transcriptional regulatory protein GlnR Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
P40138 2.83e-13 71 29 3 164 1 cyaB Adenylate cyclase 2 Stigmatella aurantiaca
T2KMF4 2.51e-12 68 26 4 168 3 BN863_21930 Histidine kinase P4 Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1)
P51343 2.21e-11 64 37 2 115 3 ycf29 Probable transcriptional regulator ycf29 Porphyra purpurea
Q9HV27 2.76e-11 65 41 2 96 1 PA4781 Cyclic di-GMP phosphodiesterase PA4781 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q06065 3.42e-11 65 33 1 107 1 atoC Regulatory protein AtoC Escherichia coli (strain K12)
P51586 5.28e-11 61 32 1 116 3 None Uncharacterized 14.6 kDa protein in sodA1 3'region Leptolyngbya boryana
P43501 6.72e-11 60 31 1 113 3 pilH Protein PilH Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q54YH4 2.45e-10 63 29 1 124 1 dhkB Hybrid signal transduction histidine kinase B Dictyostelium discoideum
Q54SP4 2.5e-10 63 32 4 137 2 dhkD Hybrid signal transduction histidine kinase D Dictyostelium discoideum
Q9KSB1 3.01e-10 62 31 2 118 1 VC_1348 Probable cyclic di-GMP phosphodiesterase VC_1348 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q2ILG8 3.31e-10 62 33 3 133 3 cheB6 Protein-glutamate methylesterase/protein-glutamine glutaminase 6 Anaeromyxobacter dehalogenans (strain 2CP-C)
P23221 5.95e-10 60 29 1 127 3 fixJ Transcriptional regulatory protein FixJ Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q2KCH7 1.02e-09 58 31 2 115 3 cheY Probable chemotaxis protein CheY Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q54Q69 4.42e-09 59 30 2 113 3 dhkG Hybrid signal transduction histidine kinase G Dictyostelium discoideum
Q9I4N3 6.82e-09 58 33 1 123 1 fleR Response regulator protein FleR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9ZCY9 7.65e-09 58 27 3 149 3 RP562 Putative response regulator NtrX-like Rickettsia prowazekii (strain Madrid E)
Q9K998 7.96e-09 57 32 3 136 3 dctR Probable C4-dicarboxylate response regulator DctR Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q8FGP6 8.41e-09 55 33 2 111 3 cheY Chemotaxis protein CheY Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q68WH4 8.8e-09 58 26 3 149 3 RT0550 Putative response regulator NtrX-like Rickettsia typhi (strain ATCC VR-144 / Wilmington)
P0AE69 9.5e-09 55 33 2 111 3 cheY Chemotaxis protein CheY Shigella flexneri
P0AE67 9.5e-09 55 33 2 111 1 cheY Chemotaxis protein CheY Escherichia coli (strain K12)
P0AE68 9.5e-09 55 33 2 111 3 cheY Chemotaxis protein CheY Escherichia coli O157:H7
P30855 1.3e-08 58 34 1 105 1 evgS Sensor protein EvgS Escherichia coli (strain K12)
P52936 1.34e-08 57 37 2 96 3 spo0A Stage 0 sporulation protein A homolog Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
G7WMP8 1.62e-08 55 34 5 116 1 filR2 Probable methanogenesis regulatory protein FilR2 Methanothrix harundinacea (strain 6Ac)
P52929 1.85e-08 56 33 2 103 3 spo0A Stage 0 sporulation protein A (Fragment) Brevibacillus parabrevis
Q9KQD5 2.23e-08 54 32 2 111 1 VC_2065 Chemotaxis protein CheY-3 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A0A0H3AMJ9 2.23e-08 54 32 2 111 1 cheY-3 Chemotaxis protein CheY-3 Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
P52942 2.29e-08 54 29 1 115 3 spo0F Sporulation initiation phosphotransferase F Bacillus thuringiensis subsp. kurstaki
Q4UL27 2.31e-08 57 26 3 149 3 RF_0895 Putative response regulator NtrX-like Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
P38889 2.32e-08 57 31 1 106 1 SKN7 Transcription factor SKN7 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
O05251 2.51e-08 55 34 3 107 3 malR Transcriptional regulatory protein MalR Bacillus subtilis (strain 168)
Q51455 2.54e-08 53 30 2 107 3 cheY Chemotaxis protein CheY Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q8KIY1 2.63e-08 57 27 5 166 1 tmoS Sensor histidine kinase TmoS Pseudomonas mendocina
Q9FAD7 3.3e-08 53 34 3 111 3 cheY Chemotaxis protein CheY Enterobacter cloacae
P14375 3.37e-08 56 31 1 114 1 zraR Transcriptional regulatory protein ZraR Escherichia coli (strain K12)
P41789 3.8e-08 56 30 3 136 1 glnG DNA-binding transcriptional regulator NtrC Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q9APD9 3.92e-08 56 32 3 137 3 zraR Transcriptional regulatory protein ZraR Klebsiella oxytoca
P52938 3.98e-08 55 28 5 161 3 spo0A Stage 0 sporulation protein A homolog Clostridioides difficile
Q8H7S7 4.03e-08 56 29 1 109 2 RR21 Two-component response regulator ORR21 Oryza sativa subsp. japonica
A2XE31 4.03e-08 56 29 1 109 3 RR21 Two-component response regulator ORR21 Oryza sativa subsp. indica
P0C5S5 4.15e-08 56 30 4 119 3 luxO Luminescence regulatory protein LuxO Vibrio harveyi
A7MVC2 4.15e-08 56 30 4 119 1 luxO Luminescence regulatory protein LuxO Vibrio campbellii (strain ATCC BAA-1116)
P0A2D5 4.17e-08 53 31 2 111 1 cheY Chemotaxis protein CheY Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2D6 4.17e-08 53 31 2 111 3 cheY Chemotaxis protein CheY Salmonella typhi
Q8X613 4.34e-08 56 31 1 114 3 zraR Transcriptional regulatory protein ZraR Escherichia coli O157:H7
Q1RJS1 4.37e-08 56 26 2 136 3 RBE_0312 Putative response regulator NtrX-like Rickettsia bellii (strain RML369-C)
P52940 4.79e-08 55 37 3 98 3 spo0A Stage 0 sporulation protein A homolog Clostridium pasteurianum
Q87MX7 4.91e-08 56 30 4 119 3 luxO Regulatory protein LuxO Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
P96126 5.17e-08 53 31 3 119 3 cheY Chemotaxis protein CheY Treponema pallidum (strain Nichols)
E0X9C7 5.45e-08 56 27 5 166 1 todS Sensor histidine kinase TodS Pseudomonas putida (strain DOT-T1E)
P58402 5.45e-08 56 33 1 105 3 evgS Sensor protein EvgS Escherichia coli O157:H7
P48359 5.74e-08 54 40 1 66 3 ycf29 Probable transcriptional regulator ycf29 Cyanophora paradoxa
Q7MM78 6.15e-08 55 29 2 126 3 luxO Regulatory protein LuxO Vibrio vulnificus (strain YJ016)
Q8CWJ5 6.15e-08 55 29 2 126 3 luxO Regulatory protein LuxO Vibrio vulnificus (strain CMCP6)
P9WGM3 6.17e-08 54 32 3 114 1 pdtaR Transcriptional regulatory protein PdtaR Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM2 6.17e-08 54 32 3 114 3 pdtaR Transcriptional regulatory protein PdtaR Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q92HC2 6.2e-08 55 27 2 111 3 RC0849 Putative response regulator NtrX-like Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Q10WZ6 6.39e-08 55 31 6 146 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Trichodesmium erythraeum (strain IMS101)
Q869S5 6.94e-08 55 30 3 121 1 dokA Hybrid signal transduction protein dokA Dictyostelium discoideum
Q5A4X5 7.02e-08 55 30 1 108 3 SKN7 Transcription factor SKN7 Candida albicans (strain SC5314 / ATCC MYA-2876)
O49397 7.68e-08 55 32 1 109 1 ARR10 Two-component response regulator ARR10 Arabidopsis thaliana
Q8FW53 8.39e-08 52 28 1 116 3 divK Polar-differentiation response regulator DivK Brucella suis biovar 1 (strain 1330)
A9WYT1 8.39e-08 52 28 1 116 3 divK Polar-differentiation response regulator DivK Brucella suis (strain ATCC 23445 / NCTC 10510)
A5VUU3 8.39e-08 52 28 1 116 3 divK Polar-differentiation response regulator DivK Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q8YC73 8.39e-08 52 28 1 116 3 divK Polar-differentiation response regulator DivK Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
A9MBQ2 8.39e-08 52 28 1 116 3 divK Polar-differentiation response regulator DivK Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q7BBW0 8.39e-08 52 28 1 116 1 divK Polar-differentiation response regulator DivK Brucella abortus biovar 1 (strain 9-941)
Q2YKN1 8.39e-08 52 28 1 116 3 divK Polar-differentiation response regulator DivK Brucella abortus (strain 2308)
B2SB45 8.39e-08 52 28 1 116 3 divK Polar-differentiation response regulator DivK Brucella abortus (strain S19)
Q5A599 8.49e-08 55 28 2 132 1 NIK1 Histidine protein kinase NIK1 Candida albicans (strain SC5314 / ATCC MYA-2876)
P09432 9.05e-08 55 30 2 130 3 ntrC DNA-binding transcriptional regulator NtrC Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
Q86AT9 9.11e-08 55 28 2 124 3 dhkI-1 Hybrid signal transduction histidine kinase I Dictyostelium discoideum
O25153 1e-07 55 28 3 120 1 cheAY Sensor histidine kinase CheAY Helicobacter pylori (strain ATCC 700392 / 26695)
A6X580 1.02e-07 52 28 1 116 3 divK Polar-differentiation response regulator DivK Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
P0AFB8 1.1e-07 55 31 2 119 1 glnG DNA-binding transcriptional regulator NtrC Escherichia coli (strain K12)
P0AFB9 1.1e-07 55 31 2 119 3 glnG DNA-binding transcriptional regulator NtrC Escherichia coli O157:H7
Q8D0P1 1.11e-07 52 30 2 111 3 cheY Chemotaxis protein CheY Yersinia pestis
P52941 1.62e-07 53 30 4 125 3 spo0A Stage 0 sporulation protein A homolog Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
P25852 1.74e-07 54 31 1 106 1 zraR Transcriptional regulatory protein ZraR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0C0F6 1.76e-07 54 32 3 114 1 rpfC Sensory/regulatory protein RpfC Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
P39486 1.94e-07 53 30 4 120 3 dctR Probable C4-dicarboxylate response regulator DctR Priestia megaterium
Q8Z333 2.01e-07 54 31 1 106 3 zraR Transcriptional regulatory protein ZraR Salmonella typhi
P18769 2.23e-07 54 29 3 119 1 frzE Gliding motility regulatory protein Myxococcus xanthus
P0C0F7 2.26e-07 54 32 3 114 1 rpfC Sensory/regulatory protein RpfC Xanthomonas campestris pv. campestris (strain 8004)
A5W4E3 2.39e-07 54 27 5 166 1 todS Sensor histidine kinase TodS Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
P0AEC4 2.54e-07 54 32 2 116 3 arcB Aerobic respiration control sensor protein ArcB Shigella flexneri
P0AEC3 2.54e-07 54 32 2 116 1 arcB Aerobic respiration control sensor protein ArcB Escherichia coli (strain K12)
P13632 2.63e-07 53 31 1 112 1 dctD C4-dicarboxylate transport transcriptional regulatory protein DctD Rhizobium meliloti (strain 1021)
P58363 2.64e-07 53 32 2 116 3 arcB Aerobic respiration control sensor protein ArcB Escherichia coli O157:H7
P0AEV3 2.96e-07 53 33 1 101 3 rssB Regulator of RpoS Shigella flexneri
P0AEV1 2.96e-07 53 33 1 101 1 rssB Regulator of RpoS Escherichia coli (strain K12)
P0AEV2 2.96e-07 53 33 1 101 3 rssB Regulator of RpoS Escherichia coli O157:H7
P10577 3.14e-07 53 26 2 132 1 ntrC DNA-binding transcriptional regulator NtrC Rhizobium meliloti (strain 1021)
Q1D359 3.37e-07 53 31 3 118 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Myxococcus xanthus (strain DK1622)
Q54YZ9 3.42e-07 53 28 1 122 3 dhkJ Hybrid signal transduction histidine kinase J Dictyostelium discoideum
O29221 3.73e-07 53 29 2 104 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
O14283 3.75e-07 53 31 1 102 1 prr1 Transcription factor prr1 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
P62598 3.79e-07 53 32 1 109 2 ARR12 Two-component response regulator ARR12 Arabidopsis thaliana
Q9SXL4 4.34e-07 53 38 1 63 1 AHK1 Histidine kinase 1 Arabidopsis thaliana
Q9HU19 4.55e-07 53 33 1 115 3 dctD C4-dicarboxylate transport transcriptional regulatory protein DctD Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q6H805 4.99e-07 53 31 1 109 2 RR24 Two-component response regulator ORR24 Oryza sativa subsp. japonica
A2X1N2 5.08e-07 53 31 1 109 3 RR24 Two-component response regulator ORR24 Oryza sativa subsp. indica
P03029 5.32e-07 53 34 2 111 1 ntrC DNA-binding transcriptional regulator NtrC Klebsiella pneumoniae
Q9KT84 6.1e-07 52 26 1 115 1 luxO Regulatory protein LuxO Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q9WY30 6.26e-07 52 31 2 118 1 TM_0186 Cyclic di-GMP phosphodiesterase TM_0186 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q5SML5 6.34e-07 52 31 1 109 2 RR22 Two-component response regulator ORR22 Oryza sativa subsp. japonica
B8B3I4 6.34e-07 52 31 1 109 3 RR22 Two-component response regulator ORR22 Oryza sativa subsp. indica
Q8EQQ3 6.63e-07 52 36 3 94 3 lytT Sensory transduction protein LytT Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q7XQA6 9.16e-07 50 29 5 122 2 RR6 Two-component response regulator ORR6 Oryza sativa subsp. japonica
Q93P00 9.25e-07 50 29 2 111 3 cheY Chemotaxis protein CheY Yersinia enterocolitica
A2XYV5 9.34e-07 50 29 5 122 2 RR6 Two-component response regulator ORR6 Oryza sativa subsp. indica
A5VW00 1.37e-06 50 24 3 160 3 ftcR Flagellar transcriptional regulator FtcR Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q8FUS8 1.55e-06 50 25 3 160 3 ftcR Flagellar transcriptional regulator FtcR Brucella suis biovar 1 (strain 1330)
Q8YDL7 1.55e-06 50 25 3 160 1 ftcR Flagellar transcriptional regulator FtcR Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q576I4 1.55e-06 50 25 3 160 3 ftcR Flagellar transcriptional regulator FtcR Brucella abortus biovar 1 (strain 9-941)
Q2YJF8 1.55e-06 50 25 3 160 3 ftcR Flagellar transcriptional regulator FtcR Brucella abortus (strain 2308)
O74539 1.68e-06 52 31 2 110 1 mak3 Peroxide stress-activated histidine kinase mak3 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q9AAK0 1.97e-06 51 34 3 106 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
P48027 2.05e-06 51 26 1 112 3 gacS Sensor protein GacS Pseudomonas syringae pv. syringae
Q53228 2.1e-06 50 27 1 106 1 regA Photosynthetic apparatus regulatory protein RegA Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
A7N6S2 2.29e-06 51 30 1 115 1 cqsS CAI-1 autoinducer sensor kinase/phosphatase CqsS Vibrio campbellii (strain ATCC BAA-1116)
P0DMC5 2.47e-06 51 28 1 105 1 rcsC Sensor histidine kinase RcsC Escherichia coli (strain K12)
P10576 2.51e-06 50 27 2 129 3 ntrC DNA-binding transcriptional regulator NtrC Bradyrhizobium sp. (strain RP501 Parasponia)
Q9FXD6 2.58e-06 50 30 3 112 1 ARR11 Two-component response regulator ARR11 Arabidopsis thaliana
P06628 2.69e-06 48 29 1 115 1 spo0F Sporulation initiation phosphotransferase F Bacillus subtilis (strain 168)
Q54SK5 2.73e-06 51 27 3 122 3 dhkM Hybrid signal transduction histidine kinase M Dictyostelium discoideum
Q6K9T0 2.85e-06 48 25 3 117 2 RR3 Two-component response regulator ORR3 Oryza sativa subsp. japonica
Q4GZK8 2.85e-06 48 25 3 117 2 RR3 Two-component response regulator ORR3 Oryza sativa subsp. indica
A3BE68 3e-06 50 23 1 140 2 HK1 Probable histidine kinase 1 Oryza sativa subsp. japonica
A2YFR6 3e-06 50 23 1 140 3 HK1 Probable histidine kinase 1 Oryza sativa subsp. indica
Q56128 3.6e-06 50 27 1 108 3 rcsC Sensor histidine kinase RcsC Salmonella typhi
P44845 3.71e-06 49 30 3 115 3 narP Nitrate/nitrite response regulator protein homolog Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P06534 4.06e-06 50 28 2 118 1 spo0A Stage 0 sporulation protein A Bacillus subtilis (strain 168)
Q9FGT7 4.22e-06 50 33 2 109 2 ARR18 Two-component response regulator ARR18 Arabidopsis thaliana
Q9KL96 4.86e-06 49 34 4 116 3 VC_A0850 Uncharacterized response regulatory protein VC_A0850 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P96602 4.86e-06 49 34 4 131 3 dctR Probable C4-dicarboxylate response regulator DctR Bacillus subtilis (strain 168)
Q9ZTP3 4.88e-06 50 32 4 124 1 EIN4 Protein EIN4 Arabidopsis thaliana
Q0D3B6 5.08e-06 50 30 3 112 2 PRR37 Two-component response regulator-like PRR37 Oryza sativa subsp. japonica
A2YQ93 5.08e-06 50 30 3 112 2 PRR37 Two-component response regulator-like PRR37 Oryza sativa subsp. indica
P0DMC6 5.26e-06 50 28 1 105 1 rcsC Sensor histidine kinase RcsC Escherichia coli
Q6H468 5.66e-06 48 29 3 116 2 RR11 Two-component response regulator ORR11 Oryza sativa subsp. japonica
B8AFR8 5.66e-06 48 29 3 116 3 RR11 Two-component response regulator ORR11 Oryza sativa subsp. indica
Q39T95 5.82e-06 49 31 1 103 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
P71403 6.46e-06 47 27 2 108 1 cheY1 Chemotaxis protein CheY1 Helicobacter pylori (strain ATCC 700392 / 26695)
P58662 6.63e-06 50 27 1 105 3 rcsC Sensor histidine kinase RcsC Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q9F8D7 7.1e-06 49 26 1 112 3 gacS Sensor histidine kinase GacS Pseudomonas protegens (strain DSM 19095 / LMG 27888 / CFBP 6595 / CHA0)
Q4UU85 7.82e-06 49 28 2 133 1 rpfG Cyclic di-GMP phosphodiesterase response regulator RpfG Xanthomonas campestris pv. campestris (strain 8004)
P59342 8.38e-06 49 26 2 127 3 barA Signal transduction histidine-protein kinase BarA Shigella flexneri
P23747 8.7e-06 49 29 1 129 1 algB Alginate biosynthesis transcriptional regulatory protein AlgB Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q04848 8.92e-06 49 26 1 123 3 ntrC DNA-binding transcriptional regulator NtrC Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
A1W0A5 9.33e-06 47 26 3 126 3 cheY Chemotaxis protein CheY homolog Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
P0C635 9.33e-06 47 26 3 126 3 cheY Chemotaxis protein CheY homolog Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
A8FMH1 9.33e-06 47 26 3 126 3 cheY Chemotaxis protein CheY homolog Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
P58253 9.45e-06 48 34 4 99 3 spo0A Stage 0 sporulation protein A homolog Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
P0AEC5 9.54e-06 49 26 2 127 1 barA Signal transduction histidine-protein kinase BarA Escherichia coli (strain K12)
P0AEC6 9.54e-06 49 26 2 127 1 barA Signal transduction histidine-protein kinase BarA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AEC7 9.54e-06 49 26 2 127 3 barA Signal transduction histidine-protein kinase BarA Escherichia coli O157:H7
Q2HWH1 1.08e-05 47 27 2 109 2 RR5 Two-component response regulator ORR5 Oryza sativa subsp. japonica
Q4GZK6 1.08e-05 47 27 2 109 2 RR5 Two-component response regulator ORR5 Oryza sativa subsp. indica
G0SB31 1.2e-05 49 29 2 105 1 SKN7 Transcription factor SKN7 Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)
Q9ZM64 1.22e-05 46 27 2 108 3 cheY1 Chemotaxis protein CheY1 Helicobacter pylori (strain J99 / ATCC 700824)
Q88AQ2 1.24e-05 48 29 1 124 3 algB Alginate biosynthesis transcriptional regulatory protein AlgB Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
P10046 1.31e-05 48 29 3 114 3 dctD C4-dicarboxylate transport transcriptional regulatory protein DctD Rhizobium leguminosarum
P24908 1.31e-05 47 31 2 107 1 PA0034 Putative transcriptional regulator Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q54RP6 1.31e-05 49 27 2 115 3 dhkL Hybrid signal transduction histidine kinase L Dictyostelium discoideum
Q5N6V8 1.36e-05 48 28 3 139 3 RR26 Two-component response regulator ORR26 Oryza sativa subsp. japonica
Q9ZWJ9 1.41e-05 48 31 1 92 1 ARR2 Two-component response regulator ARR2 Arabidopsis thaliana
Q940D0 1.45e-05 48 27 2 111 1 ARR1 Two-component response regulator ARR1 Arabidopsis thaliana
Q88RJ6 1.57e-05 48 29 1 124 3 algB Alginate biosynthesis transcriptional regulatory protein AlgB Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
P0A4H2 1.59e-05 47 32 2 109 1 bvgA Virulence factors putative positive transcription regulator BvgA Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
P0A4H4 1.59e-05 47 32 2 109 3 bvgA Virulence factors putative positive transcription regulator BvgA Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
P0A4H3 1.59e-05 47 32 2 109 3 bvgA Virulence factors putative positive transcription regulator BvgA Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
P52931 1.86e-05 47 26 2 123 3 spo0A Stage 0 sporulation protein A (Fragment) Niallia circulans
P28787 1.89e-05 48 40 1 64 3 ntrC DNA-binding transcriptional regulator NtrC Proteus hauseri
Q8D5Z6 1.97e-05 48 30 2 109 3 luxQ Autoinducer 2 sensor kinase/phosphatase LuxQ Vibrio vulnificus (strain CMCP6)
Q7MD16 1.99e-05 48 30 2 109 3 luxQ Autoinducer 2 sensor kinase/phosphatase LuxQ Vibrio vulnificus (strain YJ016)
P45709 2.08e-05 45 31 2 112 3 ccdB Protein CcdB Bacillus subtilis (strain 168)
Q551X9 2.11e-05 48 24 1 121 3 dhkF Hybrid signal transduction histidine kinase F Dictyostelium discoideum
P26487 2.16e-05 47 39 2 73 3 fixJ Transcriptional regulatory protein FixJ Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
Q67W50 2.45e-05 48 27 1 109 3 RR25 Two-component response regulator ORR25 Oryza sativa subsp. japonica
P62640 2.49e-05 47 27 2 118 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
P0AFU5 2.58e-05 47 28 1 121 1 qseF Transcriptional regulatory protein QseF Escherichia coli O157:H7
P0AFU4 2.58e-05 47 28 1 121 1 glrR Transcriptional regulatory protein GlrR Escherichia coli (strain K12)
O32197 2.61e-05 47 27 6 171 2 liaR Transcriptional regulatory protein LiaR Bacillus subtilis (strain 168)
Q6K8X6 2.63e-05 48 30 1 109 2 RR23 Two-component response regulator ORR23 Oryza sativa subsp. japonica
P96686 2.89e-05 47 27 3 128 3 ydfI Transcriptional regulatory protein YdfI Bacillus subtilis (strain 168)
B8AEH1 2.94e-05 47 30 1 109 3 RR23 Two-component response regulator ORR23 Oryza sativa subsp. indica
Q86CZ2 3.44e-05 47 24 3 129 1 dhkK Hybrid signal transduction histidine kinase K Dictyostelium discoideum
O14002 3.59e-05 47 31 3 119 3 mak2 Peroxide stress-activated histidine kinase mak2 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q9KM66 3.66e-05 47 28 1 114 1 cqsS CAI-1 autoinducer sensor kinase/phosphatase CqsS Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q9ZWS9 3.67e-05 47 34 2 72 1 ARR3 Two-component response regulator ARR3 Arabidopsis thaliana
P52934 3.78e-05 47 29 2 108 1 spo0A Stage 0 sporulation protein A Geobacillus stearothermophilus
O82798 4.07e-05 47 33 2 72 1 ARR4 Two-component response regulator ARR4 Arabidopsis thaliana
Q9ZWS6 4.09e-05 46 33 2 72 1 ARR6 Two-component response regulator ARR6 Arabidopsis thaliana
Q3ADA6 4.11e-05 47 25 2 105 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
P0AED6 4.69e-05 46 28 2 116 3 uvrY Response regulator UvrY Shigella flexneri
P0AED5 4.69e-05 46 28 2 116 1 uvrY Response regulator UvrY Escherichia coli (strain K12)
P62637 4.82e-05 47 36 3 95 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
Q67P67 4.83e-05 47 32 1 78 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
P66797 4.92e-05 46 28 2 116 3 uvrY Response regulator UvrY Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P66798 4.92e-05 46 28 2 116 3 uvrY Response regulator UvrY Escherichia coli O157:H7
Q04849 5.01e-05 47 28 2 132 3 ntrX Nitrogen assimilation regulatory protein NtrX Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
P0A4I4 5.15e-05 46 26 2 118 3 spo0A Stage 0 sporulation protein A Bacillus thuringiensis
P0A4I3 5.15e-05 46 26 2 118 3 spo0A Stage 0 sporulation protein A Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q3LWR6 6.19e-05 46 30 2 85 3 todT Response regulator protein TodT Pseudomonas putida
I7CA98 6.19e-05 46 30 2 85 1 todT Response regulator protein TodT Pseudomonas putida (strain DOT-T1E)
A5W4E2 6.19e-05 46 30 2 85 1 todT Response regulator protein TodT Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q9SB04 6.73e-05 45 27 3 92 1 ARR5 Two-component response regulator ARR5 Arabidopsis thaliana
P94586 7.5e-05 46 33 1 68 5 ywpD Putative uncharacterized protein YwpD Bacillus subtilis (strain 168)
Q10N34 8.12e-05 46 29 4 115 2 PRR73 Two-component response regulator-like PRR73 Oryza sativa subsp. japonica
A2XFB7 8.12e-05 46 29 4 115 2 PRR73 Two-component response regulator-like PRR73 Oryza sativa subsp. indica
P45671 8.49e-05 46 26 2 123 3 ntrC DNA-binding transcriptional regulator NtrC Azospirillum brasilense
Q87GU5 8.92e-05 46 30 2 103 3 luxQ Autoinducer 2 sensor kinase/phosphatase LuxQ Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q689G6 9.07e-05 46 29 2 112 2 PRR95 Two-component response regulator-like PRR95 Oryza sativa subsp. japonica
Q8D4U6 0.000102 45 34 3 101 3 VV2_1193 Uncharacterized response regulatory protein VV2_1193 Vibrio vulnificus (strain CMCP6)
Q8L9Y3 0.000109 45 28 2 110 1 ARR14 Two-component response regulator ARR14 Arabidopsis thaliana
Q7N5T1 0.000118 45 30 3 103 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q1IQS9 0.000124 45 29 2 111 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Koribacter versatilis (strain Ellin345)
P0AE41 0.000126 45 29 6 147 3 ypdB Transcriptional regulatory protein YpdB Shigella flexneri
P0AE39 0.000126 45 29 6 147 1 ypdB Transcriptional regulatory protein YpdB Escherichia coli (strain K12)
P0AE40 0.000126 45 29 6 147 3 ypdB Transcriptional regulatory protein YpdB Escherichia coli O157:H7
P24072 0.000139 43 27 2 117 1 cheY Chemotaxis protein CheY Bacillus subtilis (strain 168)
Q8KR08 0.00014 45 29 2 85 1 tmoT Response regulator protein TmoT Pseudomonas mendocina
Q8EQW0 0.000147 45 28 1 78 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q5SML4 0.000149 45 27 3 120 2 HK2 Probable histidine kinase 2 Oryza sativa subsp. japonica
A2YA15 0.000149 45 27 3 120 3 HK2 Probable histidine kinase 2 Oryza sativa subsp. indica
F4JZT3 0.000155 43 26 2 108 2 ARR24 Two-component response regulator 24 Arabidopsis thaliana
Q9M9B9 0.000157 45 25 2 112 2 ARR19 Putative two-component response regulator ARR19 Arabidopsis thaliana

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_01225
Feature type CDS
Gene ompR
Product DNA-binding response regulator, OmpR family, contains REC and winged-helix (wHTH) domain
Location 223616 - 224284 (strand: 1)
Length 669 (nucleotides) / 222 (amino acids)

Contig

Accession ZDB_679
Length 398279 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_241
Orthogroup size 8
N. genomes 6

Actions

Genomic region

Domains

PF00072 Response regulator receiver domain
PF00486 Transcriptional regulatory protein, C terminal

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0745 Signal transduction mechanisms (T)
Transcription (K)
TK DNA-binding response regulator, OmpR family, contains REC and winged-helix (wHTH) domain

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K07665 two-component system, OmpR family, copper resistance phosphate regulon response regulator CusR Two-component system Imipenem resistance, repression of porin OprD

Protein Sequence

MKILLIEDHEKTGSWVKKGLEEAGFIVDITADGRDGLYLALENNYRLVILDIMLPGMDGWEVLKILRTAKMVPVICLTARDAVADRVKGLELGANDYLVKPFSFSELLARVRNQLRTSQPASKVIEIADLSIDLTRHDVQRGGVKISLTRQEYSLLLFFALHSEEILPRTLIACEVWGMDFESDTNIVDVAVRRLRKKIDDDHDRKLIETVRGMGYRLNGSE

Flanking regions ( +/- flanking 50bp)

ATTAAAATACACTGATGCAGGATGTACAGGTAAAATTCCGGATTATAAAAATGAAAATATTACTGATTGAAGATCATGAAAAGACCGGCAGCTGGGTTAAAAAGGGATTAGAGGAAGCCGGATTTATTGTTGATATCACGGCAGATGGCAGAGACGGGTTGTATCTTGCTCTGGAGAACAATTACCGGCTGGTTATTCTTGATATTATGTTGCCCGGTATGGATGGCTGGGAAGTGCTGAAAATATTGAGAACCGCCAAAATGGTACCGGTTATTTGTCTGACAGCCAGGGATGCAGTTGCTGACCGGGTAAAAGGACTGGAGCTGGGCGCGAATGATTATCTGGTTAAACCGTTTTCATTTTCCGAATTACTGGCGAGAGTCCGGAATCAGCTGCGTACTTCTCAACCAGCTTCCAAAGTGATTGAGATCGCCGATCTCAGCATTGATCTGACCCGTCATGATGTACAGCGGGGAGGCGTGAAAATATCGCTGACACGTCAGGAATATTCACTGTTGCTTTTTTTTGCGCTGCATTCAGAGGAGATCCTGCCCAGAACACTGATTGCCTGTGAGGTGTGGGGAATGGATTTTGAGAGTGATACCAATATTGTCGATGTGGCTGTCCGGCGGCTCAGAAAAAAAATAGATGACGATCATGATCGTAAATTAATTGAAACTGTCCGTGGTATGGGATACCGCCTGAACGGATCGGAATGATGAAAATACGCTCACTGAGATTTAAAATTGTATCATTATTTATGTTGCTG