Homologs in group_174

Help

8 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_00870 FBDBKF_00870 100.0 Morganella morganii S1 higA Antitoxin HigA
NLDBIP_02785 NLDBIP_02785 100.0 Morganella morganii S4 higA Antitoxin HigA
LHKJJB_04300 LHKJJB_04300 100.0 Morganella morganii S3 higA Antitoxin HigA
HKOGLL_02745 HKOGLL_02745 100.0 Morganella morganii S5 higA Antitoxin HigA
F4V73_RS06860 F4V73_RS06860 82.0 Morganella psychrotolerans - XRE family transcriptional regulator
F4V73_RS10155 F4V73_RS10155 26.3 Morganella psychrotolerans - helix-turn-helix domain-containing protein
F4V73_RS13455 F4V73_RS13455 42.4 Morganella psychrotolerans - XRE family transcriptional regulator
PMI_RS15475 PMI_RS15475 25.6 Proteus mirabilis HI4320 - helix-turn-helix domain-containing protein

Distribution of the homologs in the orthogroup group_174

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_174

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P9WJA7 1.15e-10 57 45 0 59 1 higA1 Antitoxin HigA1 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WJA6 1.15e-10 57 45 0 59 3 higA1 Antitoxin HigA1 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
O53467 1.4e-05 43 38 1 68 1 higA2 Putative antitoxin HigA2 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_00675
Feature type CDS
Gene higA
Product Antitoxin HigA
Location 152721 - 153023 (strand: 1)
Length 303 (nucleotides) / 100 (amino acids)

Contig

Accession ZDB_213
Length 680219 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_174
Orthogroup size 9
N. genomes 7

Actions

Genomic region

Domains

PF01381 Helix-turn-helix

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3620 Transcription (K) K Predicted transcriptional regulator, contains an XRE-type HTH domain (archaeal members contain CBS pair)

Protein Sequence

MGKSLRQLLAEEKPEVAAAARVQADEILLNIHLAELREKVKKTQVEMAQALGIKQPTVAGMEKPGRDVKLSTLRRYVDAIGGKLNIDVELPDGTHYMFRV

Flanking regions ( +/- flanking 50bp)

AGTCACAACAGATAATTTTGCAGCGTGGTTTGCAAAAACAGGAGTTAACAATGGGAAAGTCACTCAGACAACTGCTGGCTGAGGAAAAGCCGGAAGTCGCGGCTGCTGCACGGGTTCAGGCGGATGAGATCCTGCTGAATATCCATCTGGCGGAGCTGCGGGAGAAAGTGAAGAAAACACAGGTGGAAATGGCGCAGGCACTGGGAATAAAACAGCCGACAGTCGCAGGGATGGAAAAACCGGGGCGTGATGTCAAATTATCCACGCTGAGACGCTATGTGGATGCCATCGGCGGAAAACTGAATATTGATGTTGAACTGCCGGACGGCACGCATTATATGTTCCGGGTCTGATACGGGATACTGCGGATAAAACAGAGAAATAAACAGGAGAGGTAAACGTT