Homologs in group_243

Help

7 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_02360 FBDBKF_02360 53.1 Morganella morganii S1 azoR FMN-dependent NADH-azoreductase
EHELCC_02830 EHELCC_02830 53.1 Morganella morganii S2 azoR FMN-dependent NADH-azoreductase
NLDBIP_00630 NLDBIP_00630 53.1 Morganella morganii S4 azoR FMN-dependent NADH-azoreductase
LHKJJB_01405 LHKJJB_01405 53.1 Morganella morganii S3 azoR FMN-dependent NADH-azoreductase
HKOGLL_01445 HKOGLL_01445 53.1 Morganella morganii S5 azoR FMN-dependent NADH-azoreductase
F4V73_RS04740 F4V73_RS04740 55.1 Morganella psychrotolerans - FMN-dependent NADH-azoreductase
PMI_RS05745 PMI_RS05745 94.9 Proteus mirabilis HI4320 - FMN-dependent NADH-azoreductase

Distribution of the homologs in the orthogroup group_243

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_243

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q7N511 1.25e-35 122 59 0 98 3 azoR FMN-dependent NADH:quinone oxidoreductase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A1JN84 4.38e-33 116 54 0 98 3 azoR FMN-dependent NADH:quinone oxidoreductase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q66A90 6.62e-33 115 54 0 97 3 azoR FMN-dependent NADH:quinone oxidoreductase Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TIW7 6.62e-33 115 54 0 97 3 azoR FMN-dependent NADH:quinone oxidoreductase Yersinia pestis (strain Pestoides F)
Q1CIR9 6.62e-33 115 54 0 97 3 azoR FMN-dependent NADH:quinone oxidoreductase Yersinia pestis bv. Antiqua (strain Nepal516)
Q8ZE60 6.62e-33 115 54 0 97 1 azoR FMN-dependent NADH:quinone oxidoreductase Yersinia pestis
Q1C7D4 6.62e-33 115 54 0 97 3 azoR FMN-dependent NADH:quinone oxidoreductase Yersinia pestis bv. Antiqua (strain Antiqua)
A7FHR1 6.62e-33 115 54 0 97 3 azoR FMN-dependent NADH:quinone oxidoreductase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q088W8 1.13e-32 115 54 0 97 3 azoR FMN-dependent NADH:quinone oxidoreductase Shewanella frigidimarina (strain NCIMB 400)
A7MEJ8 2.43e-32 114 54 0 97 3 azoR FMN-dependent NADH:quinone oxidoreductase Cronobacter sakazakii (strain ATCC BAA-894)
Q32FL5 2.6e-32 114 53 0 97 3 azoR FMN-dependent NADH:quinone oxidoreductase Shigella dysenteriae serotype 1 (strain Sd197)
Q3Z1D9 2.83e-32 114 53 0 97 3 azoR FMN-dependent NADH:quinone oxidoreductase Shigella sonnei (strain Ss046)
Q320H8 2.83e-32 114 53 0 97 3 azoR FMN-dependent NADH:quinone oxidoreductase Shigella boydii serotype 4 (strain Sb227)
Q1RC02 2.83e-32 114 53 0 97 3 azoR FMN-dependent NADH:quinone oxidoreductase Escherichia coli (strain UTI89 / UPEC)
Q8X9S9 2.83e-32 114 53 0 97 3 azoR FMN-dependent NADH:quinone oxidoreductase Escherichia coli O157:H7
A7ZLK8 2.83e-32 114 53 0 97 3 azoR FMN-dependent NADH:quinone oxidoreductase Escherichia coli O139:H28 (strain E24377A / ETEC)
Q83R81 2.86e-32 114 53 0 97 3 azoR FMN-dependent NADH:quinone oxidoreductase Shigella flexneri
Q0T407 2.86e-32 114 53 0 97 3 azoR FMN-dependent NADH:quinone oxidoreductase Shigella flexneri serotype 5b (strain 8401)
P41407 2.89e-32 114 53 0 97 1 azoR FMN-dependent NADH:quinone oxidoreductase Escherichia coli (strain K12)
B1ISN3 2.89e-32 114 53 0 97 3 azoR FMN-dependent NADH:quinone oxidoreductase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A7ZZX1 2.89e-32 114 53 0 97 3 azoR FMN-dependent NADH:quinone oxidoreductase Escherichia coli O9:H4 (strain HS)
Q0TI03 3.67e-32 114 53 0 97 3 azoR FMN-dependent NADH:quinone oxidoreductase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q8FHN0 4.14e-32 114 53 0 97 3 azoR FMN-dependent NADH:quinone oxidoreductase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q6LQR4 1.08e-31 112 52 0 97 3 azoR1 FMN-dependent NADH:quinone oxidoreductase 1 Photobacterium profundum (strain SS9)
A9MQU9 1.29e-31 112 54 0 97 3 azoR FMN-dependent NADH:quinone oxidoreductase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q87PP9 1.58e-31 112 54 0 97 3 azoR FMN-dependent NADH:quinone oxidoreductase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
A8AGG0 3.18e-31 111 52 0 97 3 azoR FMN-dependent NADH:quinone oxidoreductase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
A1REN3 1.92e-30 109 51 0 97 3 azoR FMN-dependent NADH:quinone oxidoreductase Shewanella sp. (strain W3-18-1)
A4Y2H2 1.92e-30 109 51 0 97 3 azoR FMN-dependent NADH:quinone oxidoreductase Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
Q6D5N6 2.31e-30 109 51 0 97 3 azoR FMN-dependent NADH:quinone oxidoreductase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q57P18 6.81e-30 108 58 0 87 3 azoR FMN-dependent NADH:quinone oxidoreductase Salmonella choleraesuis (strain SC-B67)
P63462 7.84e-30 108 58 0 87 1 azoR FMN-dependent NADH:quinone oxidoreductase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P63463 7.84e-30 108 58 0 87 3 azoR FMN-dependent NADH:quinone oxidoreductase Salmonella typhi
A9MXQ2 7.84e-30 108 58 0 87 3 azoR FMN-dependent NADH:quinone oxidoreductase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PHS8 7.84e-30 108 58 0 87 3 azoR FMN-dependent NADH:quinone oxidoreductase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q12IH3 8.44e-30 107 53 0 97 3 azoR FMN-dependent NADH:quinone oxidoreductase Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
A6WI50 1.6e-29 107 50 0 97 3 azoR FMN-dependent NADH:quinone oxidoreductase Shewanella baltica (strain OS185)
A9KXA9 1.66e-29 107 50 0 97 3 azoR FMN-dependent NADH:quinone oxidoreductase Shewanella baltica (strain OS195)
A3CZE0 1.71e-29 107 50 0 97 3 azoR FMN-dependent NADH:quinone oxidoreductase Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8E4C0 1.73e-29 107 50 0 97 3 azoR FMN-dependent NADH:quinone oxidoreductase Shewanella baltica (strain OS223)
A4SMX2 1.87e-29 107 51 1 98 3 azoR FMN-dependent NADH:quinone oxidoreductase Aeromonas salmonicida (strain A449)
Q7MK12 3.9e-29 106 48 0 98 3 azoR FMN-dependent NADH:quinone oxidoreductase Vibrio vulnificus (strain YJ016)
Q8DA68 4.44e-29 106 48 0 98 3 azoR FMN-dependent NADH:quinone oxidoreductase Vibrio vulnificus (strain CMCP6)
A0KRZ0 9.89e-29 105 48 0 98 3 azoR FMN-dependent NADH:quinone oxidoreductase Shewanella sp. (strain ANA-3)
Q0HQC2 1.03e-28 105 48 0 98 3 azoR FMN-dependent NADH:quinone oxidoreductase Shewanella sp. (strain MR-7)
Q0HNG6 1.03e-28 105 48 0 98 3 azoR FMN-dependent NADH:quinone oxidoreductase Shewanella sp. (strain MR-4)
A3QIU7 2.32e-28 104 50 0 98 3 azoR FMN-dependent NADH:quinone oxidoreductase Shewanella loihica (strain ATCC BAA-1088 / PV-4)
Q21E80 2.42e-28 104 61 0 80 3 azoR FMN-dependent NADH:quinone oxidoreductase Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q8E990 2.65e-28 104 48 0 97 3 azoR FMN-dependent NADH:quinone oxidoreductase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
A8FPZ7 3.85e-28 103 48 0 98 3 azoR FMN-dependent NADH:quinone oxidoreductase Shewanella sediminis (strain HAW-EB3)
B4RTK8 9.85e-28 102 52 0 98 3 azoR FMN-dependent NADH:quinone oxidoreductase Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
A1SB44 1.2e-27 102 50 0 91 3 azoR FMN-dependent NADH:quinone oxidoreductase Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
B3PKG0 2.21e-27 102 56 0 87 3 azoR FMN-dependent NADH:quinone oxidoreductase Cellvibrio japonicus (strain Ueda107)
Q2SUH7 2.28e-27 101 48 0 98 3 azoR FMN-dependent NADH:quinone oxidoreductase Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q0VTN3 5.18e-27 100 48 0 97 3 azoR FMN-dependent NADH:quinone oxidoreductase Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q3KGD1 9.61e-27 100 53 0 96 3 azoR2 FMN-dependent NADH:quinone oxidoreductase 2 Pseudomonas fluorescens (strain Pf0-1)
A1SUA7 1.26e-26 100 46 0 98 3 azoR FMN-dependent NADH:quinone oxidoreductase Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
Q47G91 1.19e-25 97 47 0 97 3 azoR FMN-dependent NADH:quinone oxidoreductase Dechloromonas aromatica (strain RCB)
Q63QG7 1.46e-25 97 45 0 98 3 azoR FMN-dependent NADH:quinone oxidoreductase Burkholderia pseudomallei (strain K96243)
Q3JNA7 1.46e-25 97 45 0 98 3 azoR FMN-dependent NADH:quinone oxidoreductase Burkholderia pseudomallei (strain 1710b)
Q62DD3 1.46e-25 97 45 0 98 3 azoR FMN-dependent NADH:quinone oxidoreductase Burkholderia mallei (strain ATCC 23344)
C1DED8 1.56e-25 97 50 0 98 3 azoR FMN-dependent NADH:quinone oxidoreductase Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
Q39K00 2.37e-25 96 52 0 87 3 azoR6 FMN-dependent NADH:quinone oxidoreductase 6 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q88EC8 2.64e-25 96 51 0 97 3 azoR2 FMN-dependent NADH:quinone oxidoreductase 2 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q2NSV8 9.99e-25 95 48 0 97 3 azoR FMN-dependent NADH:quinone oxidoreductase Sodalis glossinidius (strain morsitans)
B1YSF2 1.18e-24 94 52 0 87 3 azoR FMN-dependent NADH:quinone oxidoreductase Burkholderia ambifaria (strain MC40-6)
B2FKE2 1.28e-24 94 48 0 92 3 azoR FMN-dependent NADH:quinone oxidoreductase Stenotrophomonas maltophilia (strain K279a)
Q7WFP6 1.39e-24 95 47 1 99 3 azoR FMN-dependent NADH:quinone oxidoreductase Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
A9I4K2 3.32e-24 94 51 1 91 3 azoR FMN-dependent NADH:quinone oxidoreductase Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
B1XW54 3.47e-24 94 45 0 98 3 azoR FMN-dependent NADH:quinone oxidoreductase Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)
Q7W488 4.49e-24 93 46 1 99 3 azoR FMN-dependent NADH:quinone oxidoreductase Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q4KGG0 4.55e-24 93 50 0 96 3 azoR2 FMN-dependent NADH:quinone oxidoreductase 2 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q0C3K3 1.08e-23 92 46 2 101 3 azoR FMN-dependent NADH:quinone oxidoreductase Hyphomonas neptunium (strain ATCC 15444)
A1KAY0 1.52e-23 92 49 0 87 3 azoR FMN-dependent NADH:quinone oxidoreductase Azoarcus sp. (strain BH72)
B2JHJ1 1.84e-23 91 50 0 87 3 azoR FMN-dependent NADH:quinone oxidoreductase Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
Q2KVB0 6.58e-23 90 47 1 97 3 azoR FMN-dependent NADH:quinone oxidoreductase Bordetella avium (strain 197N)
Q15SU5 6.8e-23 90 46 0 98 3 azoR FMN-dependent NADH:quinone oxidoreductase Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q9I2E2 8.07e-23 90 50 1 88 1 azoR2 FMN-dependent NADH:quinone oxidoreductase 2 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9HZ17 1.1e-22 90 45 0 98 1 azoR3 FMN-dependent NADH:quinone oxidoreductase 3 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q8XQG9 1.89e-22 89 50 1 90 3 azoR FMN-dependent NADH:quinone oxidoreductase Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q7NWH3 7.07e-22 87 44 1 90 3 azoR FMN-dependent NADH:quinone oxidoreductase Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q390T2 2.86e-21 86 48 0 80 3 azoR4 FMN-dependent NADH:quinone oxidoreductase 4 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
C1D6X4 4.43e-21 85 49 1 95 3 azoR FMN-dependent NADH:quinone oxidoreductase Laribacter hongkongensis (strain HLHK9)
C4LEW9 8.99e-21 84 41 0 98 3 azoR FMN-dependent NADH:quinone oxidoreductase Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
Q2K9C7 1.44e-20 84 43 1 95 3 azoR1 FMN-dependent NADH:quinone oxidoreductase 1 Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q5P2Y9 2.57e-20 83 44 0 85 3 azoR FMN-dependent NADH:quinone oxidoreductase Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q4KC17 3.85e-20 83 45 1 98 3 azoR5 FMN-dependent NADH:quinone oxidoreductase 5 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q1MHV8 4.02e-20 83 43 1 95 3 azoR FMN-dependent NADH:quinone oxidoreductase Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
B5ZZC8 4.72e-20 83 43 1 95 3 azoR FMN-dependent NADH:quinone oxidoreductase Rhizobium leguminosarum bv. trifolii (strain WSM2304)
A4G2N3 5.36e-20 82 48 1 90 3 azoR FMN-dependent NADH:quinone oxidoreductase Herminiimonas arsenicoxydans
Q3KD08 1.03e-19 82 42 1 98 3 azoR3 FMN-dependent NADH:quinone oxidoreductase 3 Pseudomonas fluorescens (strain Pf0-1)
Q880L8 2.4e-19 81 48 1 88 3 azoR1 FMN-dependent NADH:quinone oxidoreductase 1 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q3M1N6 2.71e-19 81 45 0 90 3 azoR1 FMN-dependent NADH:quinone oxidoreductase 1 Trichormus variabilis (strain ATCC 29413 / PCC 7937)
Q3BUY7 3.1e-19 80 44 0 88 3 azoR1 FMN-dependent NADH:quinone oxidoreductase 1 Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q5ZT75 4.07e-19 80 47 1 100 3 azoR FMN-dependent NADH:quinone oxidoreductase Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
P58902 4.67e-19 80 43 0 88 3 azoR1 FMN-dependent NADH:quinone oxidoreductase 1 Xanthomonas axonopodis pv. citri (strain 306)
C3MAW0 7.09e-19 80 44 1 101 3 azoR FMN-dependent NADH:quinone oxidoreductase Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q88IY3 2.28e-18 78 43 1 88 1 azoR1 FMN-dependent NADH:quinone oxidoreductase 1 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q2SMF5 2.59e-18 78 50 0 77 3 azoR1 FMN-dependent NADH:quinone oxidoreductase 1 Hahella chejuensis (strain KCTC 2396)
Q48JI0 2.89e-18 78 43 1 99 3 azoR FMN-dependent NADH:quinone oxidoreductase Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
A6U839 3.12e-18 78 42 1 101 3 azoR FMN-dependent NADH:quinone oxidoreductase Sinorhizobium medicae (strain WSM419)
A5UEK0 3.49e-18 78 41 1 97 3 azoR FMN-dependent NADH:quinone oxidoreductase Haemophilus influenzae (strain PittGG)
Q390D0 3.68e-18 78 47 2 87 3 azoR5 FMN-dependent NADH:quinone oxidoreductase 5 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q5QYY9 4.01e-18 77 43 1 101 3 azoR1 FMN-dependent NADH:quinone oxidoreductase 1 Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q92QI7 5.32e-18 77 42 1 101 3 azoR FMN-dependent NADH:quinone oxidoreductase Rhizobium meliloti (strain 1021)
A1VMH6 5.53e-18 78 45 1 90 3 azoR FMN-dependent NADH:quinone oxidoreductase Polaromonas naphthalenivorans (strain CJ2)
Q28UD5 6.87e-18 77 43 1 97 3 azoR1 FMN-dependent NADH:quinone oxidoreductase 1 Jannaschia sp. (strain CCS1)
Q4QK76 7.77e-18 77 40 1 97 3 azoR FMN-dependent NADH:quinone oxidoreductase Haemophilus influenzae (strain 86-028NP)
Q8UG34 8.89e-18 77 43 1 88 3 azoR FMN-dependent NADH:quinone oxidoreductase Agrobacterium fabrum (strain C58 / ATCC 33970)
Q4ZS35 9.06e-18 77 45 1 88 3 azoR FMN-dependent NADH:quinone oxidoreductase Pseudomonas syringae pv. syringae (strain B728a)
A5UBX3 1.46e-17 76 41 1 97 3 azoR FMN-dependent NADH:quinone oxidoreductase Haemophilus influenzae (strain PittEE)
Q39M92 1.74e-17 76 45 2 91 3 azoR7 FMN-dependent NADH:quinone oxidoreductase 7 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q3BNP7 1.86e-17 76 44 1 90 3 azoR2 FMN-dependent NADH:quinone oxidoreductase 2 Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
P43013 2.33e-17 75 39 1 97 3 azoR FMN-dependent NADH:quinone oxidoreductase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A6VTC3 3.55e-17 75 45 1 86 3 azoR FMN-dependent NADH:quinone oxidoreductase Marinomonas sp. (strain MWYL1)
Q2N970 4.68e-17 75 37 1 101 3 azoR FMN-dependent NADH:quinone oxidoreductase Erythrobacter litoralis (strain HTCC2594)
Q0KBB2 5.29e-17 75 42 1 97 3 azoR FMN-dependent NADH:quinone oxidoreductase Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q5H0Z4 6.23e-17 74 40 0 88 3 azoR FMN-dependent NADH:quinone oxidoreductase Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
Q2P3X9 6.23e-17 74 40 0 88 3 azoR FMN-dependent NADH:quinone oxidoreductase Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
A9C3B1 9.18e-17 74 43 1 90 3 azoR FMN-dependent NADH:quinone oxidoreductase Delftia acidovorans (strain DSM 14801 / SPH-1)
Q471X2 1.2e-16 74 45 1 87 3 azoR1 FMN-dependent NADH:quinone oxidoreductase 1 Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
A5EF62 1.91e-16 73 46 2 89 3 azoR FMN-dependent NADH:quinone oxidoreductase Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
P58903 1.95e-16 73 44 1 88 3 azoR2 FMN-dependent NADH:quinone oxidoreductase 2 Xanthomonas axonopodis pv. citri (strain 306)
B2IKT2 4.44e-16 72 41 1 89 3 azoR FMN-dependent NADH:quinone oxidoreductase Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIMB 8712)
Q9L867 4.93e-16 72 40 1 91 3 azoR FMN-dependent NADH:quinone oxidoreductase Azospirillum brasilense
Q46W52 8.18e-16 72 38 2 94 3 azoR2 FMN-dependent NADH:quinone oxidoreductase 2 Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
A1W8C6 1.15e-15 72 43 1 88 3 azoR FMN-dependent NADH:quinone oxidoreductase Acidovorax sp. (strain JS42)
B9MI46 1.27e-15 71 43 1 88 3 azoR FMN-dependent NADH:quinone oxidoreductase Acidovorax ebreus (strain TPSY)
C0ZIX8 1.66e-15 71 38 1 83 3 azoR FMN-dependent NADH:quinone oxidoreductase Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)
Q31DX4 1.75e-15 71 41 1 101 3 azoR FMN-dependent NADH:quinone oxidoreductase Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q3IVU8 1.92e-15 70 43 0 85 3 azoR FMN-dependent NADH:quinone oxidoreductase Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
B0TWJ9 2.06e-15 70 40 1 101 3 azoR FMN-dependent NADH:quinone oxidoreductase Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
B9KUU6 2.07e-15 70 43 0 85 3 azoR FMN-dependent NADH:quinone oxidoreductase Cereibacter sphaeroides (strain KD131 / KCTC 12085)
A3PQD8 2.28e-15 70 43 0 85 3 azoR FMN-dependent NADH:quinone oxidoreductase Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
B7KYE7 2.95e-15 70 43 2 95 3 azoR FMN-dependent NADH:quinone oxidoreductase Methylorubrum extorquens (strain CM4 / NCIMB 13688)
B8IER1 6.6e-15 69 39 2 102 3 azoR FMN-dependent NADH:quinone oxidoreductase Methylobacterium nodulans (strain LMG 21967 / CNCM I-2342 / ORS 2060)
B1ZKG7 8.07e-15 69 42 2 95 3 azoR FMN-dependent NADH:quinone oxidoreductase Methylorubrum populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001)
A9W4C5 9.65e-15 69 42 2 95 3 azoR FMN-dependent NADH:quinone oxidoreductase Methylorubrum extorquens (strain PA1)
Q4KEN7 1.13e-14 69 37 2 101 3 azoR4 FMN-dependent NADH:quinone oxidoreductase 4 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q9K5P5 1.55e-14 68 40 1 94 3 azoR3 FMN-dependent NADH:quinone oxidoreductase 3 Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q81R20 2.24e-14 68 40 1 94 3 azoR3 FMN-dependent NADH:quinone oxidoreductase 3 Bacillus anthracis
B7GLH3 2.37e-14 68 44 1 83 3 azoR FMN-dependent NADH:quinone oxidoreductase Anoxybacillus flavithermus (strain DSM 21510 / WK1)
Q630J1 2.62e-14 68 36 1 83 3 azoR4 FMN-dependent NADH:quinone oxidoreductase 4 Bacillus cereus (strain ZK / E33L)
C4L0W8 2.74e-14 68 41 0 80 3 azoR FMN-dependent NADH:quinone oxidoreductase Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b)
Q814L8 2.88e-14 68 34 1 83 3 azoR3 FMN-dependent NADH:quinone oxidoreductase 3 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q72X39 2.94e-14 68 34 1 83 3 azoR4 FMN-dependent NADH:quinone oxidoreductase 4 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q81JP2 3.34e-14 67 34 1 83 1 azoR4 FMN-dependent NADH:quinone oxidoreductase 4 Bacillus anthracis
Q6HAM6 3.34e-14 67 34 1 83 3 azoR3 FMN-dependent NADH:quinone oxidoreductase 3 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q6HJC2 9.09e-14 67 39 1 94 3 azoR2 FMN-dependent NADH:quinone oxidoreductase 2 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q484U8 1.23e-13 66 37 1 90 3 azoR1 FMN-dependent NADH:quinone oxidoreductase 1 Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q3SJT0 1.42e-13 66 36 0 95 3 azoR FMN-dependent NADH:quinone oxidoreductase Thiobacillus denitrificans (strain ATCC 25259)
A6LU79 1.43e-13 66 41 0 80 3 azoR FMN-dependent NADH:quinone oxidoreductase Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
Q8YV76 1.53e-13 66 40 3 102 3 azoR FMN-dependent NADH:quinone oxidoreductase Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q220J4 1.68e-13 65 41 1 89 3 azoR FMN-dependent NADH:quinone oxidoreductase Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
A5GAC6 2.31e-13 65 39 1 82 3 azoR FMN-dependent NADH:quinone oxidoreductase Geotalea uraniireducens (strain Rf4)
B5EGQ4 2.33e-13 65 33 2 103 3 azoR FMN-dependent NADH:quinone oxidoreductase Citrifermentans bemidjiense (strain ATCC BAA-1014 / DSM 16622 / JCM 12645 / Bem)
Q5KUC3 3.27e-13 65 37 1 99 3 azoR FMN-dependent NADH:quinone oxidoreductase Geobacillus kaustophilus (strain HTA426)
Q9X4K2 3.45e-13 65 37 1 99 3 azoR FMN-dependent NADH:quinone oxidoreductase Geobacillus stearothermophilus
Q3MEA0 4.37e-13 65 39 3 102 3 azoR2 FMN-dependent NADH:quinone oxidoreductase 2 Trichormus variabilis (strain ATCC 29413 / PCC 7937)
B3E8C4 6.12e-13 64 37 1 82 3 azoR FMN-dependent NADH:quinone oxidoreductase Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)
B8EJL7 7.45e-13 64 38 1 91 3 azoR FMN-dependent NADH:quinone oxidoreductase Methylocella silvestris (strain DSM 15510 / CIP 108128 / LMG 27833 / NCIMB 13906 / BL2)
Q63BV2 7.81e-13 64 37 1 94 3 azoR3 FMN-dependent NADH:quinone oxidoreductase 3 Bacillus cereus (strain ZK / E33L)
Q81E02 7.98e-13 64 37 1 94 3 azoR2 FMN-dependent NADH:quinone oxidoreductase 2 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q98IF8 8.64e-13 64 38 1 88 3 azoR FMN-dependent NADH:quinone oxidoreductase Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
B9E9A2 8.76e-13 64 40 1 83 3 azoR FMN-dependent NADH:quinone oxidoreductase Macrococcus caseolyticus (strain JCSC5402)
Q738X4 1.46e-12 63 38 1 94 3 azoR3 FMN-dependent NADH:quinone oxidoreductase 3 Bacillus cereus (strain ATCC 10987 / NRS 248)
P58904 1.57e-12 63 38 3 92 3 azoR FMN-dependent NADH:quinone oxidoreductase Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q0TSZ6 1.72e-12 63 38 0 81 3 azoR FMN-dependent NADH:quinone oxidoreductase Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Q63F37 2.36e-12 63 40 2 89 3 azoR1 FMN-dependent NADH:quinone oxidoreductase 1 Bacillus cereus (strain ZK / E33L)
Q0SUV5 2.43e-12 62 40 0 77 3 azoR FMN-dependent NADH:quinone oxidoreductase Clostridium perfringens (strain SM101 / Type A)
Q89K13 2.45e-12 62 39 2 96 3 azoR2 FMN-dependent NADH:quinone oxidoreductase 2 Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q8XM99 2.51e-12 62 38 0 81 3 azoR2 FMN-dependent NADH:quinone oxidoreductase 2 Clostridium perfringens (strain 13 / Type A)
O35022 2.52e-12 63 30 1 94 2 azoR1 FMN-dependent NADH:quinone oxidoreductase 1 Bacillus subtilis (strain 168)
Q81UB2 2.68e-12 63 40 2 89 1 azoR1 FMN-dependent NADH:quinone oxidoreductase 1 Bacillus anthracis
Q0A5T4 2.8e-12 62 36 2 100 3 azoR FMN-dependent NADH:quinone oxidoreductase Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q9K672 4.78e-12 62 34 1 83 3 azoR2 FMN-dependent NADH:quinone oxidoreductase 2 Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
B5Y659 6.01e-12 62 41 1 80 3 azoR FMN-dependent NADH:quinone oxidoreductase Coprothermobacter proteolyticus (strain ATCC 35245 / DSM 5265 / OCM 4 / BT)
Q722T9 6.96e-12 62 34 1 83 3 azoR1 FMN-dependent NADH:quinone oxidoreductase 1 Listeria monocytogenes serotype 4b (strain F2365)
Q89PW2 7.03e-12 61 37 3 83 3 azoR1 FMN-dependent NADH:quinone oxidoreductase 1 Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
A9H9I9 7.72e-12 61 41 2 92 3 azoR FMN-dependent NADH:quinone oxidoreductase Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / CCUG 37298 / CIP 103539 / LMG 7603 / PAl5)
A4Z112 9.35e-12 61 42 2 87 3 azoR FMN-dependent NADH:quinone oxidoreductase Bradyrhizobium sp. (strain ORS 278)
Q8Y9C1 9.52e-12 61 34 1 83 3 azoR1 FMN-dependent NADH:quinone oxidoreductase 1 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q722D2 9.99e-12 61 40 1 83 3 azoR2 FMN-dependent NADH:quinone oxidoreductase 2 Listeria monocytogenes serotype 4b (strain F2365)
C1F513 1.03e-11 61 37 2 81 3 azoR FMN-dependent NADH:quinone oxidoreductase Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / BCRC 80197 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161)
Q8Y8V6 1.04e-11 61 40 1 83 3 azoR2 FMN-dependent NADH:quinone oxidoreductase 2 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q81EX6 1.1e-11 61 34 1 83 3 azoR1 FMN-dependent NADH:quinone oxidoreductase 1 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q5FSL0 1.31e-11 60 40 3 88 3 azoR FMN-dependent NADH:quinone oxidoreductase Gluconobacter oxydans (strain 621H)
A8FA13 1.32e-11 61 40 1 83 3 azoR FMN-dependent NADH:quinone oxidoreductase Bacillus pumilus (strain SAFR-032)
Q73CJ5 1.95e-11 60 39 2 89 3 azoR1 FMN-dependent NADH:quinone oxidoreductase 1 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q739Z4 1.98e-11 60 34 1 83 3 azoR2 FMN-dependent NADH:quinone oxidoreductase 2 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q63CP4 2.06e-11 60 34 1 83 3 azoR2 FMN-dependent NADH:quinone oxidoreductase 2 Bacillus cereus (strain ZK / E33L)
Q6HK44 2.06e-11 60 34 1 83 3 azoR1 FMN-dependent NADH:quinone oxidoreductase 1 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q81RX7 2.24e-11 60 34 1 83 3 azoR2 FMN-dependent NADH:quinone oxidoreductase 2 Bacillus anthracis
B1M4X4 2.26e-11 60 36 3 103 3 azoR FMN-dependent NADH:quinone oxidoreductase Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831 / NBRC 15690 / NCIMB 10815 / 0-1)
Q92E41 2.9e-11 60 33 1 83 3 azoR1 FMN-dependent NADH:quinone oxidoreductase 1 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
A1VBA6 5.05e-11 59 37 3 101 3 azoR FMN-dependent NADH:quinone oxidoreductase Nitratidesulfovibrio vulgaris (strain DP4)
Q728Q5 5.05e-11 59 37 3 101 3 azoR FMN-dependent NADH:quinone oxidoreductase Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
Q39B00 5.24e-11 59 37 2 99 3 azoR1 FMN-dependent NADH:quinone oxidoreductase 1 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q65II8 6.08e-11 59 31 1 83 3 azoR1 FMN-dependent NADH:quinone oxidoreductase 1 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q4L9I0 7.26e-11 58 39 1 83 3 azoR FMN-dependent NADH:quinone oxidoreductase Staphylococcus haemolyticus (strain JCSC1435)
O32224 7.84e-11 58 35 1 94 1 azoR2 FMN-dependent NADH:quinone oxidoreductase 2 Bacillus subtilis (strain 168)
Q4FMI9 1.28e-10 58 36 1 88 3 azoR FMN-dependent NADH:quinone oxidoreductase Pelagibacter ubique (strain HTCC1062)
Q65EW6 1.62e-10 58 33 3 105 3 azoR2 FMN-dependent NADH:quinone oxidoreductase 2 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
A4XJK7 1.66e-10 58 42 2 80 3 azoR FMN-dependent NADH:quinone oxidoreductase Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331)
Q5WB95 5.15e-10 57 41 0 53 3 azoR FMN-dependent NADH:quinone oxidoreductase Shouchella clausii (strain KSM-K16)
Q031U1 5.17e-10 56 41 1 70 3 azoR FMN-dependent NADH:quinone oxidoreductase Lactococcus lactis subsp. cremoris (strain SK11)
B2IX28 5.25e-10 56 40 2 81 3 azoR FMN-dependent NADH:quinone oxidoreductase Nostoc punctiforme (strain ATCC 29133 / PCC 73102)
Q9CIH9 6.11e-10 56 41 1 70 3 azoR2 FMN-dependent NADH:quinone oxidoreductase 2 Lactococcus lactis subsp. lactis (strain IL1403)
Q6GKA4 6.68e-10 56 37 1 83 3 azoR FMN-dependent NADH:quinone oxidoreductase Staphylococcus aureus (strain MRSA252)
A8Z0H0 7.25e-10 56 37 1 83 3 azoR FMN-dependent NADH:quinone oxidoreductase Staphylococcus aureus (strain USA300 / TCH1516)
Q99X11 7.25e-10 56 37 1 83 1 azoR FMN-dependent NADH:quinone oxidoreductase Staphylococcus aureus (strain N315)
Q5HJG8 7.25e-10 56 37 1 83 3 azoR FMN-dependent NADH:quinone oxidoreductase Staphylococcus aureus (strain COL)
A5IP80 7.25e-10 56 37 1 83 3 azoR FMN-dependent NADH:quinone oxidoreductase Staphylococcus aureus (strain JH9)
Q2G1F2 7.25e-10 56 37 1 83 3 azoR FMN-dependent NADH:quinone oxidoreductase Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FK58 7.25e-10 56 37 1 83 3 azoR FMN-dependent NADH:quinone oxidoreductase Staphylococcus aureus (strain USA300)
A6TXZ6 7.25e-10 56 37 1 83 3 azoR FMN-dependent NADH:quinone oxidoreductase Staphylococcus aureus (strain JH1)
Q8NYK7 7.48e-10 56 37 1 83 3 azoR FMN-dependent NADH:quinone oxidoreductase Staphylococcus aureus (strain MW2)
Q6GCR4 7.48e-10 56 37 1 83 3 azoR FMN-dependent NADH:quinone oxidoreductase Staphylococcus aureus (strain MSSA476)
Q2YV20 7.56e-10 56 37 1 83 3 azoR FMN-dependent NADH:quinone oxidoreductase Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q932K5 7.72e-10 56 37 1 83 3 azoR FMN-dependent NADH:quinone oxidoreductase Staphylococcus aureus (strain Mu50 / ATCC 700699)
A7WXK6 7.72e-10 56 37 1 83 3 azoR FMN-dependent NADH:quinone oxidoreductase Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q2K196 7.79e-10 56 40 3 91 3 azoR2 FMN-dependent NADH:quinone oxidoreductase 2 Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
A7Z8S7 7.81e-10 56 32 2 94 3 azoR FMN-dependent NADH:quinone oxidoreductase Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
B9MQS8 8.69e-10 56 41 2 80 3 azoR FMN-dependent NADH:quinone oxidoreductase Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / KCTC 15123 / Z-1320)
Q92DN4 1.12e-09 55 37 1 83 3 azoR2 FMN-dependent NADH:quinone oxidoreductase 2 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q6ALS1 1.56e-09 55 40 2 86 3 azoR FMN-dependent NADH:quinone oxidoreductase Desulfotalea psychrophila (strain LSv54 / DSM 12343)
A9KM25 3.33e-09 54 33 0 81 3 azoR FMN-dependent NADH:quinone oxidoreductase Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg)
Q8E1T4 3.44e-09 54 39 4 89 3 azoR FMN-dependent NADH:quinone oxidoreductase Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8E797 3.44e-09 54 39 4 89 3 azoR FMN-dependent NADH:quinone oxidoreductase Streptococcus agalactiae serotype III (strain NEM316)
Q3K3B0 3.44e-09 54 39 4 89 3 azoR FMN-dependent NADH:quinone oxidoreductase Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q97DQ1 3.66e-09 54 37 1 82 3 azoR2 FMN-dependent NADH:quinone oxidoreductase 2 Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q2SGY7 4.11e-09 54 32 3 98 3 azoR2 FMN-dependent NADH:quinone oxidoreductase 2 Hahella chejuensis (strain KCTC 2396)
B1ZNL9 4.31e-09 54 33 3 106 3 azoR FMN-dependent NADH:quinone oxidoreductase Opitutus terrae (strain DSM 11246 / JCM 15787 / PB90-1)
B9DKM7 8.27e-09 53 31 1 99 3 azoR FMN-dependent NADH:quinone oxidoreductase Staphylococcus carnosus (strain TM300)
Q4KF31 1.02e-08 53 34 3 94 3 azoR3 FMN-dependent NADH:quinone oxidoreductase 3 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q9KBG1 1.36e-08 53 29 1 81 3 azoR1 FMN-dependent NADH:quinone oxidoreductase 1 Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
A4W2Z7 1.45e-08 52 33 1 80 3 azoR FMN-dependent NADH:quinone oxidoreductase Streptococcus suis (strain 98HAH33)
Q88Y41 1.58e-08 52 37 2 85 3 azoR2 FMN-dependent NADH:quinone oxidoreductase 2 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q215Z0 1.81e-08 52 34 2 101 3 azoR FMN-dependent NADH:quinone oxidoreductase Rhodopseudomonas palustris (strain BisB18)
Q831B2 1.94e-08 52 33 1 80 1 azoR FMN-dependent NADH:quinone oxidoreductase Enterococcus faecalis (strain ATCC 700802 / V583)
Q87UC3 2.28e-08 52 33 2 86 3 azoR2 FMN-dependent NADH:quinone oxidoreductase 2 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
A8I0R2 3.64e-08 52 37 2 91 3 azoR FMN-dependent NADH:quinone oxidoreductase Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
Q3KIU3 4.29e-08 51 37 3 101 3 azoR1 FMN-dependent NADH:quinone oxidoreductase 1 Pseudomonas fluorescens (strain Pf0-1)
Q39M02 7.25e-08 51 33 1 92 3 azoR9 FMN-dependent NADH:quinone oxidoreductase 9 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q9CJ86 1.01e-07 50 33 2 99 3 azoR1 FMN-dependent NADH:quinone oxidoreductase 1 Lactococcus lactis subsp. lactis (strain IL1403)
Q890E7 4.03e-07 48 47 1 51 3 azoR1 FMN-dependent NADH:quinone oxidoreductase 1 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q9I5F3 5.3e-07 48 36 3 101 1 azoR1 FMN-dependent NAD(P)H:quinone oxidoreductase 1 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
A7IDY1 9.47e-07 48 36 3 92 3 azoR FMN-dependent NADH:quinone oxidoreductase Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)
Q5LXG9 3.55e-06 46 33 3 100 3 azoR FMN-dependent NADH:quinone oxidoreductase Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
Q6F271 3.87e-06 46 34 1 81 3 azoR1 FMN-dependent NADH:quinone oxidoreductase 1 Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1)
Q394J5 4.35e-05 43 25 2 88 3 azoR3 FMN-dependent NADH:quinone oxidoreductase 3 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q28QS5 5.85e-05 43 38 4 81 3 azoR2 FMN-dependent NADH:quinone oxidoreductase 2 Jannaschia sp. (strain CCS1)
Q2JFC9 7.31e-05 42 33 3 86 3 azoR FMN-dependent NADH:quinone oxidoreductase Frankia casuarinae (strain DSM 45818 / CECT 9043 / HFP020203 / CcI3)
Q4KJ26 0.000135 42 31 3 105 3 azoR1 FMN-dependent NADH:quinone oxidoreductase 1 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q98QP9 0.000805 40 31 2 89 3 azoR FMN-dependent NADH:quinone oxidoreductase Mycoplasmopsis pulmonis (strain UAB CTIP)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS19630
Feature type CDS
Gene -
Product NAD(P)H-dependent oxidoreductase
Location 1250516 - 1250812 (strand: -1)
Length 297 (nucleotides) / 98 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_243
Orthogroup size 8
N. genomes 7

Actions

Genomic region

Domains

PF02525 Flavodoxin-like fold

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1182 Energy production and conversion (C) C FMN-dependent NADH-azoreductase

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K01118 FMN-dependent NADH-azoreductase [EC:1.7.1.17] - -

Protein Sequence

MYNFSIFSQLKHSIDFIARAGETFKYTETGSVGLLEDKQVIVLTSRGGIHKGQPSDLIIPYLTQFLSFIGINNVQFILTEDTALGEEYAQQSHVQAQK

Flanking regions ( +/- flanking 50bp)

TTCCCGTTTTAGATCAAGCCATATTATTTGATTTTGGCAAAGATACGGCTATATATAATTTCTCCATCTTCTCTCAGTTAAAACATTCTATTGATTTTATTGCGCGTGCAGGCGAAACTTTTAAATATACTGAAACAGGGTCAGTCGGATTACTTGAAGATAAGCAAGTTATTGTATTAACGAGTCGTGGTGGGATCCATAAAGGACAACCCTCTGATTTAATTATTCCATATCTAACACAATTTTTATCATTTATTGGTATTAATAATGTACAGTTTATTCTCACCGAGGATACTGCGCTAGGCGAAGAATATGCACAACAGTCACATGTTCAAGCACAAAAATAAATAAATTTAATTATCAATAAAGAAATAATGATAAAATAAAAATATATCTA