Homologs in group_243

Help

7 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_02360 FBDBKF_02360 85.5 Morganella morganii S1 azoR FMN-dependent NADH-azoreductase
EHELCC_02830 EHELCC_02830 85.5 Morganella morganii S2 azoR FMN-dependent NADH-azoreductase
NLDBIP_00630 NLDBIP_00630 85.5 Morganella morganii S4 azoR FMN-dependent NADH-azoreductase
LHKJJB_01405 LHKJJB_01405 85.5 Morganella morganii S3 azoR FMN-dependent NADH-azoreductase
HKOGLL_01445 HKOGLL_01445 85.5 Morganella morganii S5 azoR FMN-dependent NADH-azoreductase
PMI_RS19630 PMI_RS19630 55.1 Proteus mirabilis HI4320 - NAD(P)H-dependent oxidoreductase
PMI_RS05745 PMI_RS05745 53.3 Proteus mirabilis HI4320 - FMN-dependent NADH-azoreductase

Distribution of the homologs in the orthogroup group_243

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_243

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
A7MEJ8 2.83e-87 258 60 1 200 3 azoR FMN-dependent NADH:quinone oxidoreductase Cronobacter sakazakii (strain ATCC BAA-894)
A8AGG0 1.24e-86 256 59 1 200 3 azoR FMN-dependent NADH:quinone oxidoreductase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
A9MQU9 1.63e-86 256 60 1 200 3 azoR FMN-dependent NADH:quinone oxidoreductase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q8X9S9 7.46e-86 254 58 1 200 3 azoR FMN-dependent NADH:quinone oxidoreductase Escherichia coli O157:H7
Q3Z1D9 7.8e-86 254 58 1 200 3 azoR FMN-dependent NADH:quinone oxidoreductase Shigella sonnei (strain Ss046)
Q320H8 7.8e-86 254 58 1 200 3 azoR FMN-dependent NADH:quinone oxidoreductase Shigella boydii serotype 4 (strain Sb227)
Q1RC02 7.8e-86 254 58 1 200 3 azoR FMN-dependent NADH:quinone oxidoreductase Escherichia coli (strain UTI89 / UPEC)
A7ZLK8 7.8e-86 254 58 1 200 3 azoR FMN-dependent NADH:quinone oxidoreductase Escherichia coli O139:H28 (strain E24377A / ETEC)
P41407 8.79e-86 254 58 1 200 1 azoR FMN-dependent NADH:quinone oxidoreductase Escherichia coli (strain K12)
B1ISN3 8.79e-86 254 58 1 200 3 azoR FMN-dependent NADH:quinone oxidoreductase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A7ZZX1 8.79e-86 254 58 1 200 3 azoR FMN-dependent NADH:quinone oxidoreductase Escherichia coli O9:H4 (strain HS)
Q66A90 2.63e-85 253 59 1 200 3 azoR FMN-dependent NADH:quinone oxidoreductase Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TIW7 2.63e-85 253 59 1 200 3 azoR FMN-dependent NADH:quinone oxidoreductase Yersinia pestis (strain Pestoides F)
Q1CIR9 2.63e-85 253 59 1 200 3 azoR FMN-dependent NADH:quinone oxidoreductase Yersinia pestis bv. Antiqua (strain Nepal516)
Q8ZE60 2.63e-85 253 59 1 200 1 azoR FMN-dependent NADH:quinone oxidoreductase Yersinia pestis
Q1C7D4 2.63e-85 253 59 1 200 3 azoR FMN-dependent NADH:quinone oxidoreductase Yersinia pestis bv. Antiqua (strain Antiqua)
A7FHR1 2.63e-85 253 59 1 200 3 azoR FMN-dependent NADH:quinone oxidoreductase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q32FL5 5.97e-85 252 57 1 200 3 azoR FMN-dependent NADH:quinone oxidoreductase Shigella dysenteriae serotype 1 (strain Sd197)
Q0TI03 7.59e-85 252 57 1 200 3 azoR FMN-dependent NADH:quinone oxidoreductase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q83R81 9.25e-85 252 57 1 200 3 azoR FMN-dependent NADH:quinone oxidoreductase Shigella flexneri
Q0T407 9.25e-85 252 57 1 200 3 azoR FMN-dependent NADH:quinone oxidoreductase Shigella flexneri serotype 5b (strain 8401)
Q7N511 1.13e-84 251 58 1 200 3 azoR FMN-dependent NADH:quinone oxidoreductase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q8FHN0 3.15e-84 250 57 1 200 3 azoR FMN-dependent NADH:quinone oxidoreductase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A1JN84 5.27e-84 250 58 1 200 3 azoR FMN-dependent NADH:quinone oxidoreductase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
P63462 4.65e-81 242 62 1 183 1 azoR FMN-dependent NADH:quinone oxidoreductase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P63463 4.65e-81 242 62 1 183 3 azoR FMN-dependent NADH:quinone oxidoreductase Salmonella typhi
A9MXQ2 4.65e-81 242 62 1 183 3 azoR FMN-dependent NADH:quinone oxidoreductase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PHS8 4.65e-81 242 62 1 183 3 azoR FMN-dependent NADH:quinone oxidoreductase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q6D5N6 2.92e-80 240 56 1 200 3 azoR FMN-dependent NADH:quinone oxidoreductase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q57P18 4.52e-80 240 62 1 183 3 azoR FMN-dependent NADH:quinone oxidoreductase Salmonella choleraesuis (strain SC-B67)
Q2NSV8 3.18e-73 223 53 1 200 3 azoR FMN-dependent NADH:quinone oxidoreductase Sodalis glossinidius (strain morsitans)
Q8E990 1.55e-68 211 51 3 201 3 azoR FMN-dependent NADH:quinone oxidoreductase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
A0KRZ0 3.64e-66 204 51 3 201 3 azoR FMN-dependent NADH:quinone oxidoreductase Shewanella sp. (strain ANA-3)
Q0HQC2 6.29e-66 204 51 3 201 3 azoR FMN-dependent NADH:quinone oxidoreductase Shewanella sp. (strain MR-7)
Q0HNG6 6.29e-66 204 51 3 201 3 azoR FMN-dependent NADH:quinone oxidoreductase Shewanella sp. (strain MR-4)
A3QIU7 7.5e-66 204 49 2 200 3 azoR FMN-dependent NADH:quinone oxidoreductase Shewanella loihica (strain ATCC BAA-1088 / PV-4)
Q6LQR4 7.83e-66 204 49 2 200 3 azoR1 FMN-dependent NADH:quinone oxidoreductase 1 Photobacterium profundum (strain SS9)
Q12IH3 1.13e-65 203 49 2 200 3 azoR FMN-dependent NADH:quinone oxidoreductase Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
A3CZE0 5.64e-65 201 51 3 200 3 azoR FMN-dependent NADH:quinone oxidoreductase Shewanella baltica (strain OS155 / ATCC BAA-1091)
Q87PP9 1.61e-64 200 49 2 193 3 azoR FMN-dependent NADH:quinone oxidoreductase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q7MK12 3.54e-64 199 50 3 193 3 azoR FMN-dependent NADH:quinone oxidoreductase Vibrio vulnificus (strain YJ016)
B8E4C0 7.26e-64 199 50 3 200 3 azoR FMN-dependent NADH:quinone oxidoreductase Shewanella baltica (strain OS223)
A9KXA9 1.64e-63 197 50 3 200 3 azoR FMN-dependent NADH:quinone oxidoreductase Shewanella baltica (strain OS195)
A8FPZ7 2.19e-63 197 46 2 200 3 azoR FMN-dependent NADH:quinone oxidoreductase Shewanella sediminis (strain HAW-EB3)
Q088W8 3.57e-63 197 48 2 200 3 azoR FMN-dependent NADH:quinone oxidoreductase Shewanella frigidimarina (strain NCIMB 400)
A6WI50 7.33e-63 196 49 3 200 3 azoR FMN-dependent NADH:quinone oxidoreductase Shewanella baltica (strain OS185)
Q8DA68 8.2e-63 196 49 3 193 3 azoR FMN-dependent NADH:quinone oxidoreductase Vibrio vulnificus (strain CMCP6)
A1REN3 6.36e-62 194 48 3 201 3 azoR FMN-dependent NADH:quinone oxidoreductase Shewanella sp. (strain W3-18-1)
A4Y2H2 6.36e-62 194 48 3 201 3 azoR FMN-dependent NADH:quinone oxidoreductase Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
A1SB44 6.73e-62 194 48 2 193 3 azoR FMN-dependent NADH:quinone oxidoreductase Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
A4SMX2 8.18e-60 188 48 2 200 3 azoR FMN-dependent NADH:quinone oxidoreductase Aeromonas salmonicida (strain A449)
A1SUA7 3.13e-57 182 47 2 193 3 azoR FMN-dependent NADH:quinone oxidoreductase Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
Q88EC8 1.07e-55 178 46 2 197 3 azoR2 FMN-dependent NADH:quinone oxidoreductase 2 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q4KGG0 1.09e-55 178 45 3 199 3 azoR2 FMN-dependent NADH:quinone oxidoreductase 2 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
C4LEW9 1.19e-54 175 41 1 197 3 azoR FMN-dependent NADH:quinone oxidoreductase Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
Q3KGD1 9.48e-54 173 45 2 197 3 azoR2 FMN-dependent NADH:quinone oxidoreductase 2 Pseudomonas fluorescens (strain Pf0-1)
Q47G91 3.71e-52 169 42 1 198 3 azoR FMN-dependent NADH:quinone oxidoreductase Dechloromonas aromatica (strain RCB)
C1DED8 1.02e-51 168 43 1 200 3 azoR FMN-dependent NADH:quinone oxidoreductase Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
A5UBX3 5.6e-50 163 43 4 199 3 azoR FMN-dependent NADH:quinone oxidoreductase Haemophilus influenzae (strain PittEE)
Q0VTN3 3.64e-49 161 42 1 190 3 azoR FMN-dependent NADH:quinone oxidoreductase Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q7WFP6 5e-49 161 41 2 199 3 azoR FMN-dependent NADH:quinone oxidoreductase Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
A9I4K2 5.53e-49 161 43 2 199 3 azoR FMN-dependent NADH:quinone oxidoreductase Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
Q4QK76 6.75e-49 160 41 3 200 3 azoR FMN-dependent NADH:quinone oxidoreductase Haemophilus influenzae (strain 86-028NP)
P43013 2.11e-48 159 41 3 200 3 azoR FMN-dependent NADH:quinone oxidoreductase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q7W488 2.47e-48 159 40 2 199 3 azoR FMN-dependent NADH:quinone oxidoreductase Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q9HZ17 5.38e-48 159 41 1 198 1 azoR3 FMN-dependent NADH:quinone oxidoreductase 3 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q2KVB0 2e-47 157 43 2 198 3 azoR FMN-dependent NADH:quinone oxidoreductase Bordetella avium (strain 197N)
A5UEK0 5.39e-47 155 42 4 193 3 azoR FMN-dependent NADH:quinone oxidoreductase Haemophilus influenzae (strain PittGG)
Q7NWH3 5.94e-47 155 41 3 201 3 azoR FMN-dependent NADH:quinone oxidoreductase Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q63QG7 1.5e-46 154 40 1 196 3 azoR FMN-dependent NADH:quinone oxidoreductase Burkholderia pseudomallei (strain K96243)
Q3JNA7 1.5e-46 154 40 1 196 3 azoR FMN-dependent NADH:quinone oxidoreductase Burkholderia pseudomallei (strain 1710b)
Q62DD3 1.5e-46 154 40 1 196 3 azoR FMN-dependent NADH:quinone oxidoreductase Burkholderia mallei (strain ATCC 23344)
Q390T2 1.7e-46 154 42 3 200 3 azoR4 FMN-dependent NADH:quinone oxidoreductase 4 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
B1XW54 7.1e-45 150 43 1 178 3 azoR FMN-dependent NADH:quinone oxidoreductase Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)
Q2SUH7 1.32e-44 149 39 1 196 3 azoR FMN-dependent NADH:quinone oxidoreductase Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
A4G2N3 1.45e-44 150 38 2 203 3 azoR FMN-dependent NADH:quinone oxidoreductase Herminiimonas arsenicoxydans
Q0C3K3 1.79e-44 149 39 2 196 3 azoR FMN-dependent NADH:quinone oxidoreductase Hyphomonas neptunium (strain ATCC 15444)
Q5ZT75 3.73e-44 149 38 2 201 3 azoR FMN-dependent NADH:quinone oxidoreductase Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Q5P2Y9 3.74e-44 149 42 1 178 3 azoR FMN-dependent NADH:quinone oxidoreductase Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
A1KAY0 1.82e-43 147 43 1 181 3 azoR FMN-dependent NADH:quinone oxidoreductase Azoarcus sp. (strain BH72)
Q39K00 4.85e-43 145 41 1 188 3 azoR6 FMN-dependent NADH:quinone oxidoreductase 6 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
B1YSF2 1.69e-42 144 40 1 188 3 azoR FMN-dependent NADH:quinone oxidoreductase Burkholderia ambifaria (strain MC40-6)
Q3BUY7 3.35e-42 143 40 1 181 3 azoR1 FMN-dependent NADH:quinone oxidoreductase 1 Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
P58902 1.79e-41 141 39 1 181 3 azoR1 FMN-dependent NADH:quinone oxidoreductase 1 Xanthomonas axonopodis pv. citri (strain 306)
Q4KC17 4.81e-41 140 39 3 201 3 azoR5 FMN-dependent NADH:quinone oxidoreductase 5 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
B3PKG0 1.63e-40 139 36 2 198 3 azoR FMN-dependent NADH:quinone oxidoreductase Cellvibrio japonicus (strain Ueda107)
Q2K9C7 4.85e-40 138 40 4 204 3 azoR1 FMN-dependent NADH:quinone oxidoreductase 1 Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q21E80 8.24e-40 137 36 3 204 3 azoR FMN-dependent NADH:quinone oxidoreductase Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
B2JHJ1 8.93e-40 137 39 1 183 3 azoR FMN-dependent NADH:quinone oxidoreductase Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
B2FKE2 2.47e-39 136 36 2 187 3 azoR FMN-dependent NADH:quinone oxidoreductase Stenotrophomonas maltophilia (strain K279a)
Q3KD08 3.85e-39 136 38 3 199 3 azoR3 FMN-dependent NADH:quinone oxidoreductase 3 Pseudomonas fluorescens (strain Pf0-1)
Q9L867 4.52e-39 135 40 1 185 3 azoR FMN-dependent NADH:quinone oxidoreductase Azospirillum brasilense
Q31DX4 6.22e-39 135 37 2 200 3 azoR FMN-dependent NADH:quinone oxidoreductase Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q8XQG9 1.12e-38 135 37 1 185 3 azoR FMN-dependent NADH:quinone oxidoreductase Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
A1VMH6 1.51e-38 135 39 4 189 3 azoR FMN-dependent NADH:quinone oxidoreductase Polaromonas naphthalenivorans (strain CJ2)
Q9I2E2 1.02e-37 132 40 3 184 1 azoR2 FMN-dependent NADH:quinone oxidoreductase 2 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q880L8 1.51e-37 132 36 2 195 3 azoR1 FMN-dependent NADH:quinone oxidoreductase 1 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q92QI7 1.65e-37 132 37 3 200 3 azoR FMN-dependent NADH:quinone oxidoreductase Rhizobium meliloti (strain 1021)
Q48JI0 1.89e-37 131 36 2 195 3 azoR FMN-dependent NADH:quinone oxidoreductase Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q5H0Z4 2.28e-37 131 37 1 181 3 azoR FMN-dependent NADH:quinone oxidoreductase Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
Q2P3X9 2.28e-37 131 37 1 181 3 azoR FMN-dependent NADH:quinone oxidoreductase Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
A6VTC3 2.77e-37 131 37 3 197 3 azoR FMN-dependent NADH:quinone oxidoreductase Marinomonas sp. (strain MWYL1)
B5ZZC8 3.25e-37 131 37 4 203 3 azoR FMN-dependent NADH:quinone oxidoreductase Rhizobium leguminosarum bv. trifolii (strain WSM2304)
B8IER1 4.01e-37 130 35 4 214 3 azoR FMN-dependent NADH:quinone oxidoreductase Methylobacterium nodulans (strain LMG 21967 / CNCM I-2342 / ORS 2060)
Q88IY3 8.09e-37 130 38 2 182 1 azoR1 FMN-dependent NADH:quinone oxidoreductase 1 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q8YV76 8.28e-37 130 36 3 203 3 azoR FMN-dependent NADH:quinone oxidoreductase Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q3MEA0 1.8e-36 129 35 3 203 3 azoR2 FMN-dependent NADH:quinone oxidoreductase 2 Trichormus variabilis (strain ATCC 29413 / PCC 7937)
A6U839 1.81e-36 129 37 3 200 3 azoR FMN-dependent NADH:quinone oxidoreductase Sinorhizobium medicae (strain WSM419)
Q1MHV8 2.04e-36 129 36 3 203 3 azoR FMN-dependent NADH:quinone oxidoreductase Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q4ZS35 1.21e-35 127 36 2 196 3 azoR FMN-dependent NADH:quinone oxidoreductase Pseudomonas syringae pv. syringae (strain B728a)
Q3M1N6 1.54e-35 127 33 1 198 3 azoR1 FMN-dependent NADH:quinone oxidoreductase 1 Trichormus variabilis (strain ATCC 29413 / PCC 7937)
B1ZKG7 2.5e-35 126 37 3 189 3 azoR FMN-dependent NADH:quinone oxidoreductase Methylorubrum populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001)
Q215Z0 2.63e-35 126 37 4 203 3 azoR FMN-dependent NADH:quinone oxidoreductase Rhodopseudomonas palustris (strain BisB18)
C1D6X4 8.88e-35 124 35 2 185 3 azoR FMN-dependent NADH:quinone oxidoreductase Laribacter hongkongensis (strain HLHK9)
B7KYE7 1.74e-34 124 35 3 190 3 azoR FMN-dependent NADH:quinone oxidoreductase Methylorubrum extorquens (strain CM4 / NCIMB 13688)
Q3BNP7 2.03e-34 124 36 1 184 3 azoR2 FMN-dependent NADH:quinone oxidoreductase 2 Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q220J4 2.21e-34 124 37 3 186 3 azoR FMN-dependent NADH:quinone oxidoreductase Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Q5QYY9 2.99e-34 123 37 4 198 3 azoR1 FMN-dependent NADH:quinone oxidoreductase 1 Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
B2IX28 3.74e-34 123 35 3 201 3 azoR FMN-dependent NADH:quinone oxidoreductase Nostoc punctiforme (strain ATCC 29133 / PCC 73102)
P58903 5.45e-34 123 36 1 182 3 azoR2 FMN-dependent NADH:quinone oxidoreductase 2 Xanthomonas axonopodis pv. citri (strain 306)
Q471X2 7.65e-34 122 36 2 197 3 azoR1 FMN-dependent NADH:quinone oxidoreductase 1 Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
A9W4C5 9.05e-34 122 35 3 190 3 azoR FMN-dependent NADH:quinone oxidoreductase Methylorubrum extorquens (strain PA1)
Q98IF8 1.4e-33 122 33 2 184 3 azoR FMN-dependent NADH:quinone oxidoreductase Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
B4RTK8 1.98e-33 121 34 4 203 3 azoR FMN-dependent NADH:quinone oxidoreductase Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
Q15SU5 2.04e-33 121 33 2 200 3 azoR FMN-dependent NADH:quinone oxidoreductase Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
B0TWJ9 3.52e-33 120 37 4 193 3 azoR FMN-dependent NADH:quinone oxidoreductase Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
Q8UG34 5.76e-33 120 35 2 184 3 azoR FMN-dependent NADH:quinone oxidoreductase Agrobacterium fabrum (strain C58 / ATCC 33970)
B8EJL7 1.24e-32 119 36 3 202 3 azoR FMN-dependent NADH:quinone oxidoreductase Methylocella silvestris (strain DSM 15510 / CIP 108128 / LMG 27833 / NCIMB 13906 / BL2)
Q89K13 2.13e-32 118 34 2 194 3 azoR2 FMN-dependent NADH:quinone oxidoreductase 2 Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
B9MI46 2.2e-32 119 34 2 183 3 azoR FMN-dependent NADH:quinone oxidoreductase Acidovorax ebreus (strain TPSY)
C3MAW0 3.56e-32 118 34 3 199 3 azoR FMN-dependent NADH:quinone oxidoreductase Sinorhizobium fredii (strain NBRC 101917 / NGR234)
A1W8C6 3.72e-32 118 34 2 183 3 azoR FMN-dependent NADH:quinone oxidoreductase Acidovorax sp. (strain JS42)
Q0KBB2 7.89e-32 117 35 2 197 3 azoR FMN-dependent NADH:quinone oxidoreductase Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
B1M4X4 9.09e-32 117 36 5 206 3 azoR FMN-dependent NADH:quinone oxidoreductase Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831 / NBRC 15690 / NCIMB 10815 / 0-1)
A9C3B1 9.31e-32 117 35 3 195 3 azoR FMN-dependent NADH:quinone oxidoreductase Delftia acidovorans (strain DSM 14801 / SPH-1)
A9H9I9 9.98e-32 117 36 4 186 3 azoR FMN-dependent NADH:quinone oxidoreductase Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / CCUG 37298 / CIP 103539 / LMG 7603 / PAl5)
Q0A5T4 9.37e-31 114 34 3 189 3 azoR FMN-dependent NADH:quinone oxidoreductase Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q39M92 9.64e-31 114 37 4 187 3 azoR7 FMN-dependent NADH:quinone oxidoreductase 7 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q2SMF5 1.2e-30 114 37 2 182 3 azoR1 FMN-dependent NADH:quinone oxidoreductase 1 Hahella chejuensis (strain KCTC 2396)
P58904 3.25e-30 113 38 6 189 3 azoR FMN-dependent NADH:quinone oxidoreductase Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q2N970 3.51e-30 112 34 3 200 3 azoR FMN-dependent NADH:quinone oxidoreductase Erythrobacter litoralis (strain HTCC2594)
Q722T9 4.18e-30 113 33 4 203 3 azoR1 FMN-dependent NADH:quinone oxidoreductase 1 Listeria monocytogenes serotype 4b (strain F2365)
Q8Y9C1 6.55e-30 112 33 4 203 3 azoR1 FMN-dependent NADH:quinone oxidoreductase 1 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
A7IDY1 1.72e-29 111 35 3 188 3 azoR FMN-dependent NADH:quinone oxidoreductase Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)
Q92E41 2.4e-29 110 35 3 182 3 azoR1 FMN-dependent NADH:quinone oxidoreductase 1 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q46W52 2.48e-29 110 32 3 186 3 azoR2 FMN-dependent NADH:quinone oxidoreductase 2 Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q28UD5 3.12e-29 110 40 2 150 3 azoR1 FMN-dependent NADH:quinone oxidoreductase 1 Jannaschia sp. (strain CCS1)
Q39B00 4.62e-29 110 34 3 205 3 azoR1 FMN-dependent NADH:quinone oxidoreductase 1 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q831B2 9.96e-29 109 32 4 185 1 azoR FMN-dependent NADH:quinone oxidoreductase Enterococcus faecalis (strain ATCC 700802 / V583)
Q3KIU3 1.51e-28 108 32 5 210 3 azoR1 FMN-dependent NADH:quinone oxidoreductase 1 Pseudomonas fluorescens (strain Pf0-1)
A4Z112 4.39e-28 107 34 3 181 3 azoR FMN-dependent NADH:quinone oxidoreductase Bradyrhizobium sp. (strain ORS 278)
B2IKT2 7.22e-28 107 31 3 190 3 azoR FMN-dependent NADH:quinone oxidoreductase Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIMB 8712)
A5EF62 8.27e-28 107 37 4 191 3 azoR FMN-dependent NADH:quinone oxidoreductase Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
Q4KEN7 2e-27 105 28 2 196 3 azoR4 FMN-dependent NADH:quinone oxidoreductase 4 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q81EX6 2.21e-27 105 35 4 182 3 azoR1 FMN-dependent NADH:quinone oxidoreductase 1 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q031U1 2.26e-27 105 35 3 188 3 azoR FMN-dependent NADH:quinone oxidoreductase Lactococcus lactis subsp. cremoris (strain SK11)
Q5FSL0 2.47e-27 105 34 6 199 3 azoR FMN-dependent NADH:quinone oxidoreductase Gluconobacter oxydans (strain 621H)
Q9I5F3 3.05e-27 105 30 4 202 1 azoR1 FMN-dependent NAD(P)H:quinone oxidoreductase 1 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
C1F513 8.73e-27 104 33 3 183 3 azoR FMN-dependent NADH:quinone oxidoreductase Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / BCRC 80197 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161)
Q739Z4 1.01e-26 104 34 4 182 3 azoR2 FMN-dependent NADH:quinone oxidoreductase 2 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q63CP4 1.17e-26 103 34 4 182 3 azoR2 FMN-dependent NADH:quinone oxidoreductase 2 Bacillus cereus (strain ZK / E33L)
Q6HK44 1.17e-26 103 34 4 182 3 azoR1 FMN-dependent NADH:quinone oxidoreductase 1 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q9CIH9 1.69e-26 103 34 3 188 3 azoR2 FMN-dependent NADH:quinone oxidoreductase 2 Lactococcus lactis subsp. lactis (strain IL1403)
Q81RX7 1.77e-26 103 34 4 182 3 azoR2 FMN-dependent NADH:quinone oxidoreductase 2 Bacillus anthracis
A6LU79 1.82e-26 103 33 3 189 3 azoR FMN-dependent NADH:quinone oxidoreductase Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
Q81R20 2.71e-26 103 33 6 210 3 azoR3 FMN-dependent NADH:quinone oxidoreductase 3 Bacillus anthracis
Q738X4 5.9e-26 102 33 6 210 3 azoR3 FMN-dependent NADH:quinone oxidoreductase 3 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q8Y8V6 5.96e-26 102 33 5 187 3 azoR2 FMN-dependent NADH:quinone oxidoreductase 2 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q722D2 6.36e-26 102 33 5 187 3 azoR2 FMN-dependent NADH:quinone oxidoreductase 2 Listeria monocytogenes serotype 4b (strain F2365)
B3E8C4 6.55e-26 102 30 3 189 3 azoR FMN-dependent NADH:quinone oxidoreductase Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)
Q6HJC2 6.92e-26 102 33 6 210 3 azoR2 FMN-dependent NADH:quinone oxidoreductase 2 Bacillus thuringiensis subsp. konkukian (strain 97-27)
O35022 8.78e-26 101 30 3 182 2 azoR1 FMN-dependent NADH:quinone oxidoreductase 1 Bacillus subtilis (strain 168)
Q9CJ86 9.38e-26 102 31 4 205 3 azoR1 FMN-dependent NADH:quinone oxidoreductase 1 Lactococcus lactis subsp. lactis (strain IL1403)
Q92DN4 1.05e-25 101 34 5 187 3 azoR2 FMN-dependent NADH:quinone oxidoreductase 2 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q3SJT0 1.08e-25 101 35 2 174 3 azoR FMN-dependent NADH:quinone oxidoreductase Thiobacillus denitrificans (strain ATCC 25259)
Q65II8 1.45e-25 101 30 3 182 3 azoR1 FMN-dependent NADH:quinone oxidoreductase 1 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q63BV2 2.03e-25 100 31 3 208 3 azoR3 FMN-dependent NADH:quinone oxidoreductase 3 Bacillus cereus (strain ZK / E33L)
C0ZIX8 2.32e-25 100 30 3 182 3 azoR FMN-dependent NADH:quinone oxidoreductase Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)
Q2JFC9 3.68e-25 100 34 3 180 3 azoR FMN-dependent NADH:quinone oxidoreductase Frankia casuarinae (strain DSM 45818 / CECT 9043 / HFP020203 / CcI3)
Q65EW6 9e-25 99 29 5 206 3 azoR2 FMN-dependent NADH:quinone oxidoreductase 2 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
A8LAY7 1.76e-24 98 31 3 177 3 azoR FMN-dependent NADH:quinone oxidoreductase Parafrankia sp. (strain EAN1pec)
Q88Y41 1.89e-24 98 31 5 211 3 azoR2 FMN-dependent NADH:quinone oxidoreductase 2 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q484U8 1.96e-24 97 32 3 179 3 azoR1 FMN-dependent NADH:quinone oxidoreductase 1 Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q81E02 2.11e-24 98 30 3 208 3 azoR2 FMN-dependent NADH:quinone oxidoreductase 2 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
A8I0R2 4.59e-24 97 35 4 187 3 azoR FMN-dependent NADH:quinone oxidoreductase Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
B7GLH3 7.7e-24 97 33 3 162 3 azoR FMN-dependent NADH:quinone oxidoreductase Anoxybacillus flavithermus (strain DSM 21510 / WK1)
Q4L9I0 8.61e-24 96 29 3 166 3 azoR FMN-dependent NADH:quinone oxidoreductase Staphylococcus haemolyticus (strain JCSC1435)
Q390D0 8.74e-24 96 29 3 192 3 azoR5 FMN-dependent NADH:quinone oxidoreductase 5 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q5KUC3 1.15e-23 96 29 2 184 3 azoR FMN-dependent NADH:quinone oxidoreductase Geobacillus kaustophilus (strain HTA426)
Q9X4K2 1.27e-23 96 29 2 184 3 azoR FMN-dependent NADH:quinone oxidoreductase Geobacillus stearothermophilus
Q2K196 1.82e-23 95 34 4 187 3 azoR2 FMN-dependent NADH:quinone oxidoreductase 2 Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q630J1 2.39e-23 95 29 3 182 3 azoR4 FMN-dependent NADH:quinone oxidoreductase 4 Bacillus cereus (strain ZK / E33L)
Q81JP2 3.25e-23 95 29 3 182 1 azoR4 FMN-dependent NADH:quinone oxidoreductase 4 Bacillus anthracis
Q6HAM6 3.25e-23 95 29 3 182 3 azoR3 FMN-dependent NADH:quinone oxidoreductase 3 Bacillus thuringiensis subsp. konkukian (strain 97-27)
B5EGQ4 3.47e-23 95 30 2 169 3 azoR FMN-dependent NADH:quinone oxidoreductase Citrifermentans bemidjiense (strain ATCC BAA-1014 / DSM 16622 / JCM 12645 / Bem)
B9KUU6 6.77e-23 94 31 2 183 3 azoR FMN-dependent NADH:quinone oxidoreductase Cereibacter sphaeroides (strain KD131 / KCTC 12085)
Q97DQ1 9.08e-23 94 33 5 181 3 azoR2 FMN-dependent NADH:quinone oxidoreductase 2 Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
A9KM25 1.26e-22 93 32 3 180 3 azoR FMN-dependent NADH:quinone oxidoreductase Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg)
Q0RRM3 1.3e-22 93 30 3 180 3 azoR FMN-dependent NADH:quinone oxidoreductase Frankia alni (strain DSM 45986 / CECT 9034 / ACN14a)
A3PQD8 1.5e-22 93 31 2 183 3 azoR FMN-dependent NADH:quinone oxidoreductase Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
Q72X39 1.81e-22 93 29 2 162 3 azoR4 FMN-dependent NADH:quinone oxidoreductase 4 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q3IVU8 2.11e-22 92 30 1 181 3 azoR FMN-dependent NADH:quinone oxidoreductase Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
B9E9A2 2.17e-22 93 29 5 212 3 azoR FMN-dependent NADH:quinone oxidoreductase Macrococcus caseolyticus (strain JCSC5402)
A4XJK7 2.17e-22 92 30 4 204 3 azoR FMN-dependent NADH:quinone oxidoreductase Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331)
Q28QS5 2.35e-22 92 31 6 204 3 azoR2 FMN-dependent NADH:quinone oxidoreductase 2 Jannaschia sp. (strain CCS1)
B9DKM7 3e-22 92 28 3 181 3 azoR FMN-dependent NADH:quinone oxidoreductase Staphylococcus carnosus (strain TM300)
Q932K5 3.3e-22 92 28 3 166 3 azoR FMN-dependent NADH:quinone oxidoreductase Staphylococcus aureus (strain Mu50 / ATCC 700699)
A7WXK6 3.3e-22 92 28 3 166 3 azoR FMN-dependent NADH:quinone oxidoreductase Staphylococcus aureus (strain Mu3 / ATCC 700698)
B9MQS8 3.32e-22 92 30 4 205 3 azoR FMN-dependent NADH:quinone oxidoreductase Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / KCTC 15123 / Z-1320)
A8FA13 3.49e-22 92 29 2 184 3 azoR FMN-dependent NADH:quinone oxidoreductase Bacillus pumilus (strain SAFR-032)
Q5WB95 3.79e-22 92 29 2 190 3 azoR FMN-dependent NADH:quinone oxidoreductase Shouchella clausii (strain KSM-K16)
Q9K5P5 3.92e-22 92 28 2 183 3 azoR3 FMN-dependent NADH:quinone oxidoreductase 3 Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
A8Z0H0 4.26e-22 92 28 3 166 3 azoR FMN-dependent NADH:quinone oxidoreductase Staphylococcus aureus (strain USA300 / TCH1516)
Q99X11 4.26e-22 92 28 3 166 1 azoR FMN-dependent NADH:quinone oxidoreductase Staphylococcus aureus (strain N315)
Q5HJG8 4.26e-22 92 28 3 166 3 azoR FMN-dependent NADH:quinone oxidoreductase Staphylococcus aureus (strain COL)
A5IP80 4.26e-22 92 28 3 166 3 azoR FMN-dependent NADH:quinone oxidoreductase Staphylococcus aureus (strain JH9)
Q2G1F2 4.26e-22 92 28 3 166 3 azoR FMN-dependent NADH:quinone oxidoreductase Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FK58 4.26e-22 92 28 3 166 3 azoR FMN-dependent NADH:quinone oxidoreductase Staphylococcus aureus (strain USA300)
A6TXZ6 4.26e-22 92 28 3 166 3 azoR FMN-dependent NADH:quinone oxidoreductase Staphylococcus aureus (strain JH1)
Q8NYK7 4.35e-22 92 28 3 166 3 azoR FMN-dependent NADH:quinone oxidoreductase Staphylococcus aureus (strain MW2)
Q6GCR4 4.35e-22 92 28 3 166 3 azoR FMN-dependent NADH:quinone oxidoreductase Staphylococcus aureus (strain MSSA476)
Q2YV20 4.35e-22 92 28 3 166 3 azoR FMN-dependent NADH:quinone oxidoreductase Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q814L8 4.74e-22 92 29 2 162 3 azoR3 FMN-dependent NADH:quinone oxidoreductase 3 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
A1VBA6 5.92e-22 92 30 3 203 3 azoR FMN-dependent NADH:quinone oxidoreductase Nitratidesulfovibrio vulgaris (strain DP4)
Q728Q5 5.92e-22 92 30 3 203 3 azoR FMN-dependent NADH:quinone oxidoreductase Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
Q2SGY7 6.27e-22 91 31 3 166 3 azoR2 FMN-dependent NADH:quinone oxidoreductase 2 Hahella chejuensis (strain KCTC 2396)
Q0TSZ6 7.71e-22 91 30 3 175 3 azoR FMN-dependent NADH:quinone oxidoreductase Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Q0SUV5 8.31e-22 91 30 3 175 3 azoR FMN-dependent NADH:quinone oxidoreductase Clostridium perfringens (strain SM101 / Type A)
B5Y659 9.17e-22 91 29 4 205 3 azoR FMN-dependent NADH:quinone oxidoreductase Coprothermobacter proteolyticus (strain ATCC 35245 / DSM 5265 / OCM 4 / BT)
B1ZNL9 1.65e-21 90 33 7 192 3 azoR FMN-dependent NADH:quinone oxidoreductase Opitutus terrae (strain DSM 11246 / JCM 15787 / PB90-1)
O32224 2.8e-21 90 29 2 175 1 azoR2 FMN-dependent NADH:quinone oxidoreductase 2 Bacillus subtilis (strain 168)
Q8XM99 3.51e-21 89 31 3 176 3 azoR2 FMN-dependent NADH:quinone oxidoreductase 2 Clostridium perfringens (strain 13 / Type A)
A5GAC6 4.22e-21 89 30 2 160 3 azoR FMN-dependent NADH:quinone oxidoreductase Geotalea uraniireducens (strain Rf4)
Q4FMI9 7.47e-21 88 30 4 186 3 azoR FMN-dependent NADH:quinone oxidoreductase Pelagibacter ubique (strain HTCC1062)
A4W2Z7 9.81e-21 88 28 4 192 3 azoR FMN-dependent NADH:quinone oxidoreductase Streptococcus suis (strain 98HAH33)
Q4KJ26 1.19e-20 88 28 3 196 3 azoR1 FMN-dependent NADH:quinone oxidoreductase 1 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q6GKA4 1.21e-20 88 27 3 166 3 azoR FMN-dependent NADH:quinone oxidoreductase Staphylococcus aureus (strain MRSA252)
Q0BTA0 1.45e-20 88 29 4 182 3 azoR FMN-dependent NADH:quinone oxidoreductase Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1)
A7Z8S7 4.87e-20 87 27 4 205 3 azoR FMN-dependent NADH:quinone oxidoreductase Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
Q9KBG1 6.76e-20 86 32 3 166 3 azoR1 FMN-dependent NADH:quinone oxidoreductase 1 Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
C4L0W8 7.57e-20 86 28 1 164 3 azoR FMN-dependent NADH:quinone oxidoreductase Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b)
Q9K672 9.97e-20 85 28 4 183 3 azoR2 FMN-dependent NADH:quinone oxidoreductase 2 Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q394J5 1.17e-19 85 29 3 184 3 azoR3 FMN-dependent NADH:quinone oxidoreductase 3 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q5R0V3 6.58e-19 84 28 7 214 3 azoR2 FMN-dependent NADH:quinone oxidoreductase 2 Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q82FB5 1.78e-18 82 32 6 193 3 azoR FMN-dependent NADH:quinone oxidoreductase Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q39M29 3.72e-18 82 28 6 215 3 azoR8 FMN-dependent NADH:quinone oxidoreductase 8 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
C0ZT83 4.9e-18 81 29 4 181 3 azoR FMN-dependent NADH:quinone oxidoreductase Rhodococcus erythropolis (strain PR4 / NBRC 100887)
Q6ALS1 8.11e-18 80 29 3 199 3 azoR FMN-dependent NADH:quinone oxidoreductase Desulfotalea psychrophila (strain LSv54 / DSM 12343)
Q9S1U6 4.22e-17 79 31 6 183 3 azoR FMN-dependent NADH:quinone oxidoreductase Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q81UB2 4.36e-16 76 28 4 152 1 azoR1 FMN-dependent NADH:quinone oxidoreductase 1 Bacillus anthracis
Q63F37 6.62e-16 75 28 4 152 3 azoR1 FMN-dependent NADH:quinone oxidoreductase 1 Bacillus cereus (strain ZK / E33L)
Q4KF31 7.2e-16 75 28 4 192 3 azoR3 FMN-dependent NADH:quinone oxidoreductase 3 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q47ZU7 1e-15 75 25 3 195 3 azoR2 FMN-dependent NADH:quinone oxidoreductase 2 Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q73CJ5 4.64e-15 73 28 4 152 3 azoR1 FMN-dependent NADH:quinone oxidoreductase 1 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q39M02 1.55e-14 72 26 2 189 3 azoR9 FMN-dependent NADH:quinone oxidoreductase 9 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q8E1T4 2.65e-14 71 25 5 192 3 azoR FMN-dependent NADH:quinone oxidoreductase Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8E797 2.65e-14 71 25 5 192 3 azoR FMN-dependent NADH:quinone oxidoreductase Streptococcus agalactiae serotype III (strain NEM316)
Q3K3B0 2.65e-14 71 25 5 192 3 azoR FMN-dependent NADH:quinone oxidoreductase Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q5LXG9 2.15e-13 68 26 3 179 3 azoR FMN-dependent NADH:quinone oxidoreductase Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
Q5YR63 3.3e-13 68 30 6 169 3 azoR FMN-dependent NADH:quinone oxidoreductase Nocardia farcinica (strain IFM 10152)
Q89PW2 8.72e-13 67 28 5 180 3 azoR1 FMN-dependent NADH:quinone oxidoreductase 1 Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
A6W4I5 5.7e-12 65 30 6 170 3 azoR FMN-dependent NADH:quinone oxidoreductase Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216)
Q890E7 6e-12 65 30 3 127 3 azoR1 FMN-dependent NADH:quinone oxidoreductase 1 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q2ST93 6.69e-11 62 29 6 148 3 azoR FMN-dependent NADH:quinone oxidoreductase Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154)
Q6MUK2 8.97e-11 62 28 5 152 3 azoR FMN-dependent NADH:quinone oxidoreductase Mycoplasma mycoides subsp. mycoides SC (strain CCUG 32753 / NCTC 10114 / PG1)
B3PM20 1.34e-10 61 29 6 171 3 azoR FMN-dependent NADH:quinone oxidoreductase Metamycoplasma arthritidis (strain 158L3-1)
Q87UC3 1.47e-10 61 25 4 197 3 azoR2 FMN-dependent NADH:quinone oxidoreductase 2 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q6F271 3.09e-10 60 26 4 184 3 azoR1 FMN-dependent NADH:quinone oxidoreductase 1 Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1)
Q98QP9 5.93e-10 59 25 6 203 3 azoR FMN-dependent NADH:quinone oxidoreductase Mycoplasmopsis pulmonis (strain UAB CTIP)
P47575 1.16e-09 58 25 8 202 3 azoR FMN-dependent NADH:quinone oxidoreductase Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
Q97LF7 4.48e-09 57 24 5 199 3 azoR1 FMN-dependent NADH:quinone oxidoreductase 1 Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
B2V3P0 7.33e-09 57 26 4 174 3 azoR FMN-dependent NADH:quinone oxidoreductase Clostridium botulinum (strain Alaska E43 / Type E3)
B2TRR9 1.18e-08 56 26 4 174 3 azoR FMN-dependent NADH:quinone oxidoreductase Clostridium botulinum (strain Eklund 17B / Type B)
Q6KHU1 2.47e-08 55 28 9 202 3 azoR FMN-dependent NADH:quinone oxidoreductase Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711)
Q6LFW5 3.25e-08 54 28 4 145 3 azoR2 FMN-dependent NADH:quinone oxidoreductase 2 Photobacterium profundum (strain SS9)
P75305 3.47e-08 54 23 7 198 3 azoR FMN-dependent NADH:quinone oxidoreductase Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
Q7NAW1 5.64e-08 54 28 4 148 3 azoR FMN-dependent NADH:quinone oxidoreductase Mycoplasmoides gallisepticum (strain R(low / passage 15 / clone 2))
B8I799 1.23e-06 50 22 6 216 3 azoR FMN-dependent NADH:quinone oxidoreductase Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10)
Q6F265 1.5e-06 50 26 6 174 3 azoR2 FMN-dependent NADH:quinone oxidoreductase 2 Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1)
Q8EWL4 4.69e-06 48 26 10 197 3 azoR FMN-dependent NADH:quinone oxidoreductase Malacoplasma penetrans (strain HF-2)
A0A481WNM5 1.28e-05 48 29 2 91 3 traD Ribosyldihydronicotinamide dehydrogenase-like protein traD Penicillium crustosum
Q4A6W2 4.18e-05 46 26 5 148 3 azoR FMN-dependent NADH:quinone oxidoreductase Mycoplasmopsis synoviae (strain 53)
Q399J3 5.15e-05 45 23 5 201 3 azoR2 FMN-dependent NADH:quinone oxidoreductase 2 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
A9R474 9.37e-05 44 35 4 80 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Yersinia pestis bv. Antiqua (strain Angola)
Q8ZJC5 9.37e-05 44 35 4 80 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Yersinia pestis
B1JIU3 9.37e-05 44 35 4 80 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q664Q4 9.37e-05 44 35 4 80 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TGX4 9.37e-05 44 35 4 80 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Yersinia pestis (strain Pestoides F)
Q1CCS6 9.37e-05 44 35 4 80 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Yersinia pestis bv. Antiqua (strain Nepal516)
B2K5P7 9.37e-05 44 35 4 80 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C2S8 9.37e-05 44 35 4 80 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Yersinia pestis bv. Antiqua (strain Antiqua)
A7FNQ1 0.0001 44 35 4 80 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A1JS77 0.000104 44 33 4 83 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
P16083 0.00015 44 29 4 115 1 NQO2 Ribosyldihydronicotinamide dehydrogenase [quinone] Homo sapiens
A8GKL4 0.000209 43 32 2 80 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Serratia proteamaculans (strain 568)
Q9JI75 0.000319 43 27 3 133 1 Nqo2 Ribosyldihydronicotinamide dehydrogenase [quinone] Mus musculus
Q5RBB9 0.000444 43 29 3 115 2 NQO2 Ribosyldihydronicotinamide dehydrogenase [quinone] Pongo abelii
A4WFE5 0.000513 42 31 3 82 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Enterobacter sp. (strain 638)
B2VK48 0.000581 42 32 2 80 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
A7ME22 0.000665 42 32 3 79 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Cronobacter sakazakii (strain ATCC BAA-894)
P65510 0.000672 42 31 3 82 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P65511 0.000672 42 31 3 82 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Salmonella typhi
B4TXG0 0.000672 42 31 3 82 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Salmonella schwarzengrund (strain CVM19633)
B5BH04 0.000672 42 31 3 82 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Salmonella paratyphi A (strain AKU_12601)
Q5PL20 0.000672 42 31 3 82 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4SUV8 0.000672 42 31 3 82 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Salmonella newport (strain SL254)
B4TKN3 0.000672 42 31 3 82 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Salmonella heidelberg (strain SL476)
B5R2A9 0.000672 42 31 3 82 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Salmonella enteritidis PT4 (strain P125109)
B5FJN2 0.000672 42 31 3 82 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Salmonella dublin (strain CT_02021853)
Q57J14 0.000672 42 31 3 82 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Salmonella choleraesuis (strain SC-B67)
B5F8H0 0.000672 42 31 3 82 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Salmonella agona (strain SL483)
C0Q0D4 0.000705 42 31 3 82 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Salmonella paratyphi C (strain RKS4594)
A9MT18 0.000719 42 31 3 82 3 kefG Glutathione-regulated potassium-efflux system ancillary protein KefG Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS04740
Feature type CDS
Gene -
Product FMN-dependent NADH-azoreductase
Location 1000466 - 1001068 (strand: -1)
Length 603 (nucleotides) / 200 (amino acids)

Contig

Accession term accessions NZ_VXKB01000001 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_243
Orthogroup size 8
N. genomes 7

Actions

Genomic region

Domains

PF02525 Flavodoxin-like fold

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1182 Energy production and conversion (C) C FMN-dependent NADH-azoreductase

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K01118 FMN-dependent NADH-azoreductase [EC:1.7.1.17] - -

Protein Sequence

MQKILVLKSSILAGHSHTNKMADYFIGQWRKNHADDAITVRDLSANPVPVLDNEIISGMNVPAGGTLTAHQLSANALQAELIDELFAHDVIVFTAPMYNFTIPTQLKTWLDFIASAGKTFRYTENGAEGLVLGKRAIVLTARGGFHRDQTSDLIVPFMKQFLGFIGINEIEFIFAEGVAMGEESADKAQCDARLCVEQLC

Flanking regions ( +/- flanking 50bp)

GGATGGATCCCTTCTAAGCTGAATCACATATAACAAAGACAAGGTTTACTATGCAAAAAATTCTCGTGCTCAAATCCAGTATTCTTGCGGGTCACTCTCATACCAACAAAATGGCGGATTATTTTATAGGACAATGGCGGAAAAATCATGCAGATGATGCGATTACGGTCCGTGATCTCAGCGCAAACCCGGTTCCGGTGCTTGATAATGAAATCATTTCCGGCATGAATGTTCCGGCGGGCGGAACCTTAACAGCACATCAGTTATCCGCCAATGCATTACAAGCGGAACTGATAGATGAGCTATTTGCCCATGATGTCATTGTATTCACAGCGCCAATGTATAACTTTACCATACCCACTCAACTGAAAACCTGGCTGGATTTTATCGCCTCTGCCGGTAAAACGTTCCGCTATACCGAAAACGGTGCCGAAGGTTTAGTGCTGGGTAAGCGCGCTATTGTACTGACTGCGCGCGGCGGTTTCCACCGTGATCAGACATCTGACTTAATTGTGCCGTTTATGAAACAGTTCCTGGGCTTTATCGGGATCAATGAAATTGAATTCATTTTTGCCGAAGGTGTGGCAATGGGTGAAGAGTCTGCGGATAAAGCGCAGTGTGATGCCCGCCTGTGTGTTGAACAACTGTGTTGAGCAGTTGTCCGTCTGATGACTGATTAATACCCGAATTAATACAGCAGCGG