Homologs in group_232

Help

7 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_02830 EHELCC_02830 100.0 Morganella morganii S2 azoR FMN-dependent NADH-azoreductase
NLDBIP_00630 NLDBIP_00630 100.0 Morganella morganii S4 azoR FMN-dependent NADH-azoreductase
LHKJJB_01405 LHKJJB_01405 100.0 Morganella morganii S3 azoR FMN-dependent NADH-azoreductase
HKOGLL_01445 HKOGLL_01445 100.0 Morganella morganii S5 azoR FMN-dependent NADH-azoreductase
F4V73_RS04740 F4V73_RS04740 85.5 Morganella psychrotolerans - FMN-dependent NADH-azoreductase
PMI_RS19630 PMI_RS19630 53.1 Proteus mirabilis HI4320 - NAD(P)H-dependent oxidoreductase
PMI_RS05745 PMI_RS05745 54.0 Proteus mirabilis HI4320 - FMN-dependent NADH-azoreductase

Distribution of the homologs in the orthogroup group_232

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_232

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
A7MEJ8 2.52e-89 263 61 1 199 3 azoR FMN-dependent NADH:quinone oxidoreductase Cronobacter sakazakii (strain ATCC BAA-894)
A8AGG0 2.88e-87 258 59 1 201 3 azoR FMN-dependent NADH:quinone oxidoreductase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
A9MQU9 6.12e-87 257 60 1 201 3 azoR FMN-dependent NADH:quinone oxidoreductase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q0TI03 1.13e-86 256 58 1 201 3 azoR FMN-dependent NADH:quinone oxidoreductase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q7N511 1.32e-86 256 59 1 201 3 azoR FMN-dependent NADH:quinone oxidoreductase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A1JN84 5.35e-86 255 60 1 196 3 azoR FMN-dependent NADH:quinone oxidoreductase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q8FHN0 6.3e-86 254 58 1 201 3 azoR FMN-dependent NADH:quinone oxidoreductase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q3Z1D9 6.37e-86 254 58 1 201 3 azoR FMN-dependent NADH:quinone oxidoreductase Shigella sonnei (strain Ss046)
Q320H8 6.37e-86 254 58 1 201 3 azoR FMN-dependent NADH:quinone oxidoreductase Shigella boydii serotype 4 (strain Sb227)
Q1RC02 6.37e-86 254 58 1 201 3 azoR FMN-dependent NADH:quinone oxidoreductase Escherichia coli (strain UTI89 / UPEC)
A7ZLK8 6.37e-86 254 58 1 201 3 azoR FMN-dependent NADH:quinone oxidoreductase Escherichia coli O139:H28 (strain E24377A / ETEC)
Q8X9S9 7.42e-86 254 58 1 201 3 azoR FMN-dependent NADH:quinone oxidoreductase Escherichia coli O157:H7
Q66A90 9.55e-86 254 60 1 201 3 azoR FMN-dependent NADH:quinone oxidoreductase Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TIW7 9.55e-86 254 60 1 201 3 azoR FMN-dependent NADH:quinone oxidoreductase Yersinia pestis (strain Pestoides F)
Q1CIR9 9.55e-86 254 60 1 201 3 azoR FMN-dependent NADH:quinone oxidoreductase Yersinia pestis bv. Antiqua (strain Nepal516)
Q8ZE60 9.55e-86 254 60 1 201 1 azoR FMN-dependent NADH:quinone oxidoreductase Yersinia pestis
Q1C7D4 9.55e-86 254 60 1 201 3 azoR FMN-dependent NADH:quinone oxidoreductase Yersinia pestis bv. Antiqua (strain Antiqua)
A7FHR1 9.55e-86 254 60 1 201 3 azoR FMN-dependent NADH:quinone oxidoreductase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
P41407 1.27e-85 254 58 1 199 1 azoR FMN-dependent NADH:quinone oxidoreductase Escherichia coli (strain K12)
B1ISN3 1.27e-85 254 58 1 199 3 azoR FMN-dependent NADH:quinone oxidoreductase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A7ZZX1 1.27e-85 254 58 1 199 3 azoR FMN-dependent NADH:quinone oxidoreductase Escherichia coli O9:H4 (strain HS)
Q32FL5 3.96e-85 253 57 1 201 3 azoR FMN-dependent NADH:quinone oxidoreductase Shigella dysenteriae serotype 1 (strain Sd197)
Q83R81 6.55e-85 252 57 1 201 3 azoR FMN-dependent NADH:quinone oxidoreductase Shigella flexneri
Q0T407 6.55e-85 252 57 1 201 3 azoR FMN-dependent NADH:quinone oxidoreductase Shigella flexneri serotype 5b (strain 8401)
P63462 1.43e-81 244 63 1 183 1 azoR FMN-dependent NADH:quinone oxidoreductase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P63463 1.43e-81 244 63 1 183 3 azoR FMN-dependent NADH:quinone oxidoreductase Salmonella typhi
A9MXQ2 1.43e-81 244 63 1 183 3 azoR FMN-dependent NADH:quinone oxidoreductase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PHS8 1.43e-81 244 63 1 183 3 azoR FMN-dependent NADH:quinone oxidoreductase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q6D5N6 1.69e-81 243 58 1 199 3 azoR FMN-dependent NADH:quinone oxidoreductase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q57P18 2.71e-81 243 63 1 183 3 azoR FMN-dependent NADH:quinone oxidoreductase Salmonella choleraesuis (strain SC-B67)
Q2NSV8 8.14e-77 231 56 1 199 3 azoR FMN-dependent NADH:quinone oxidoreductase Sodalis glossinidius (strain morsitans)
Q6LQR4 4.04e-71 217 51 2 201 3 azoR1 FMN-dependent NADH:quinone oxidoreductase 1 Photobacterium profundum (strain SS9)
Q12IH3 1.11e-70 216 51 2 201 3 azoR FMN-dependent NADH:quinone oxidoreductase Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
A0KRZ0 7.74e-69 211 52 3 201 3 azoR FMN-dependent NADH:quinone oxidoreductase Shewanella sp. (strain ANA-3)
Q8E990 9.32e-69 211 51 3 201 3 azoR FMN-dependent NADH:quinone oxidoreductase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
A8FPZ7 1.04e-68 211 48 2 201 3 azoR FMN-dependent NADH:quinone oxidoreductase Shewanella sediminis (strain HAW-EB3)
A3QIU7 1.05e-68 211 50 2 201 3 azoR FMN-dependent NADH:quinone oxidoreductase Shewanella loihica (strain ATCC BAA-1088 / PV-4)
Q0HQC2 1.44e-68 211 52 3 201 3 azoR FMN-dependent NADH:quinone oxidoreductase Shewanella sp. (strain MR-7)
Q0HNG6 1.44e-68 211 52 3 201 3 azoR FMN-dependent NADH:quinone oxidoreductase Shewanella sp. (strain MR-4)
Q7MK12 1.49e-68 210 50 3 202 3 azoR FMN-dependent NADH:quinone oxidoreductase Vibrio vulnificus (strain YJ016)
Q8DA68 4.17e-67 207 49 3 202 3 azoR FMN-dependent NADH:quinone oxidoreductase Vibrio vulnificus (strain CMCP6)
A1SB44 1.39e-66 206 50 2 193 3 azoR FMN-dependent NADH:quinone oxidoreductase Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
Q87PP9 2.82e-66 204 50 2 193 3 azoR FMN-dependent NADH:quinone oxidoreductase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q088W8 5.48e-66 204 50 2 200 3 azoR FMN-dependent NADH:quinone oxidoreductase Shewanella frigidimarina (strain NCIMB 400)
A3CZE0 1.07e-64 201 50 3 202 3 azoR FMN-dependent NADH:quinone oxidoreductase Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8E4C0 1.24e-63 198 49 3 202 3 azoR FMN-dependent NADH:quinone oxidoreductase Shewanella baltica (strain OS223)
A9KXA9 2.29e-63 197 49 3 202 3 azoR FMN-dependent NADH:quinone oxidoreductase Shewanella baltica (strain OS195)
A4SMX2 3.22e-63 197 49 2 200 3 azoR FMN-dependent NADH:quinone oxidoreductase Aeromonas salmonicida (strain A449)
A6WI50 3.7e-63 197 49 3 202 3 azoR FMN-dependent NADH:quinone oxidoreductase Shewanella baltica (strain OS185)
A1REN3 5.03e-63 196 48 3 202 3 azoR FMN-dependent NADH:quinone oxidoreductase Shewanella sp. (strain W3-18-1)
A4Y2H2 5.03e-63 196 48 3 202 3 azoR FMN-dependent NADH:quinone oxidoreductase Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
A1SUA7 2.04e-59 187 47 2 194 3 azoR FMN-dependent NADH:quinone oxidoreductase Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
C4LEW9 1.2e-57 183 42 1 201 3 azoR FMN-dependent NADH:quinone oxidoreductase Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
Q3KGD1 1.2e-56 180 47 3 198 3 azoR2 FMN-dependent NADH:quinone oxidoreductase 2 Pseudomonas fluorescens (strain Pf0-1)
Q4KGG0 1.27e-56 180 47 2 195 3 azoR2 FMN-dependent NADH:quinone oxidoreductase 2 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q88EC8 6.01e-56 179 45 2 205 3 azoR2 FMN-dependent NADH:quinone oxidoreductase 2 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q0VTN3 3.56e-53 171 44 2 194 3 azoR FMN-dependent NADH:quinone oxidoreductase Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
C1DED8 3.75e-53 171 43 1 194 3 azoR FMN-dependent NADH:quinone oxidoreductase Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
Q7WFP6 8.76e-53 171 44 2 199 3 azoR FMN-dependent NADH:quinone oxidoreductase Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
A5UBX3 1.43e-52 170 44 3 199 3 azoR FMN-dependent NADH:quinone oxidoreductase Haemophilus influenzae (strain PittEE)
A9I4K2 6.02e-52 169 45 2 200 3 azoR FMN-dependent NADH:quinone oxidoreductase Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
Q7W488 1.03e-51 168 43 2 199 3 azoR FMN-dependent NADH:quinone oxidoreductase Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q4QK76 2.8e-50 164 42 3 201 3 azoR FMN-dependent NADH:quinone oxidoreductase Haemophilus influenzae (strain 86-028NP)
P43013 8.39e-50 163 42 3 201 3 azoR FMN-dependent NADH:quinone oxidoreductase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UEK0 1.16e-49 162 43 4 201 3 azoR FMN-dependent NADH:quinone oxidoreductase Haemophilus influenzae (strain PittGG)
Q2SUH7 1.23e-48 160 41 2 202 3 azoR FMN-dependent NADH:quinone oxidoreductase Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q63QG7 1.43e-48 160 40 2 202 3 azoR FMN-dependent NADH:quinone oxidoreductase Burkholderia pseudomallei (strain K96243)
Q3JNA7 1.43e-48 160 40 2 202 3 azoR FMN-dependent NADH:quinone oxidoreductase Burkholderia pseudomallei (strain 1710b)
Q62DD3 1.43e-48 160 40 2 202 3 azoR FMN-dependent NADH:quinone oxidoreductase Burkholderia mallei (strain ATCC 23344)
Q9HZ17 3.35e-48 159 42 2 201 1 azoR3 FMN-dependent NADH:quinone oxidoreductase 3 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q390T2 4.99e-48 158 42 3 202 3 azoR4 FMN-dependent NADH:quinone oxidoreductase 4 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q7NWH3 9.09e-48 158 42 3 202 3 azoR FMN-dependent NADH:quinone oxidoreductase Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q2KVB0 9.56e-47 155 44 3 194 3 azoR FMN-dependent NADH:quinone oxidoreductase Bordetella avium (strain 197N)
Q47G91 1.54e-46 154 40 1 199 3 azoR FMN-dependent NADH:quinone oxidoreductase Dechloromonas aromatica (strain RCB)
Q5ZT75 3.7e-44 149 38 2 200 3 azoR FMN-dependent NADH:quinone oxidoreductase Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
B1YSF2 3.15e-43 146 41 2 186 3 azoR FMN-dependent NADH:quinone oxidoreductase Burkholderia ambifaria (strain MC40-6)
Q39K00 6.72e-43 145 42 1 183 3 azoR6 FMN-dependent NADH:quinone oxidoreductase 6 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
B3PKG0 7.93e-42 142 39 1 182 3 azoR FMN-dependent NADH:quinone oxidoreductase Cellvibrio japonicus (strain Ueda107)
B2JHJ1 8.22e-42 142 40 1 183 3 azoR FMN-dependent NADH:quinone oxidoreductase Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
B1XW54 8.68e-42 143 41 1 184 3 azoR FMN-dependent NADH:quinone oxidoreductase Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)
Q9L867 2.9e-41 141 40 1 202 3 azoR FMN-dependent NADH:quinone oxidoreductase Azospirillum brasilense
Q3BUY7 9.24e-41 140 41 1 177 3 azoR1 FMN-dependent NADH:quinone oxidoreductase 1 Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q0C3K3 1.35e-40 140 37 2 196 3 azoR FMN-dependent NADH:quinone oxidoreductase Hyphomonas neptunium (strain ATCC 15444)
A1KAY0 2.55e-40 139 40 1 181 3 azoR FMN-dependent NADH:quinone oxidoreductase Azoarcus sp. (strain BH72)
A4G2N3 2.99e-40 139 37 2 202 3 azoR FMN-dependent NADH:quinone oxidoreductase Herminiimonas arsenicoxydans
P58902 4.05e-40 138 40 1 177 3 azoR1 FMN-dependent NADH:quinone oxidoreductase 1 Xanthomonas axonopodis pv. citri (strain 306)
Q31DX4 7.47e-40 137 37 2 200 3 azoR FMN-dependent NADH:quinone oxidoreductase Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q5P2Y9 1.01e-39 137 38 1 179 3 azoR FMN-dependent NADH:quinone oxidoreductase Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q8YV76 1.3e-39 137 37 3 201 3 azoR FMN-dependent NADH:quinone oxidoreductase Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q4KC17 2.06e-39 136 37 3 196 3 azoR5 FMN-dependent NADH:quinone oxidoreductase 5 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q21E80 2.51e-39 136 36 2 188 3 azoR FMN-dependent NADH:quinone oxidoreductase Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q3KD08 1.36e-38 134 37 3 196 3 azoR3 FMN-dependent NADH:quinone oxidoreductase 3 Pseudomonas fluorescens (strain Pf0-1)
Q3MEA0 2.56e-38 134 35 3 201 3 azoR2 FMN-dependent NADH:quinone oxidoreductase 2 Trichormus variabilis (strain ATCC 29413 / PCC 7937)
Q8XQG9 9.62e-38 132 36 1 184 3 azoR FMN-dependent NADH:quinone oxidoreductase Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q9I2E2 1.79e-37 131 40 3 186 1 azoR2 FMN-dependent NADH:quinone oxidoreductase 2 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
A1VMH6 4.03e-37 131 36 1 186 3 azoR FMN-dependent NADH:quinone oxidoreductase Polaromonas naphthalenivorans (strain CJ2)
Q5H0Z4 2.12e-36 129 38 1 177 3 azoR FMN-dependent NADH:quinone oxidoreductase Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
Q2P3X9 2.12e-36 129 38 1 177 3 azoR FMN-dependent NADH:quinone oxidoreductase Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q2K9C7 3.28e-36 128 38 4 204 3 azoR1 FMN-dependent NADH:quinone oxidoreductase 1 Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q92QI7 3.61e-36 128 37 4 204 3 azoR FMN-dependent NADH:quinone oxidoreductase Rhizobium meliloti (strain 1021)
B2FKE2 4.78e-36 127 33 3 206 3 azoR FMN-dependent NADH:quinone oxidoreductase Stenotrophomonas maltophilia (strain K279a)
Q15SU5 7.43e-36 127 33 2 199 3 azoR FMN-dependent NADH:quinone oxidoreductase Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q88IY3 9.79e-36 127 37 3 186 1 azoR1 FMN-dependent NADH:quinone oxidoreductase 1 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q880L8 1.07e-35 127 34 3 201 3 azoR1 FMN-dependent NADH:quinone oxidoreductase 1 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q220J4 1.44e-35 127 36 2 184 3 azoR FMN-dependent NADH:quinone oxidoreductase Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
B2IX28 1.93e-35 126 37 2 186 3 azoR FMN-dependent NADH:quinone oxidoreductase Nostoc punctiforme (strain ATCC 29133 / PCC 73102)
Q48JI0 2.12e-35 126 34 3 201 3 azoR FMN-dependent NADH:quinone oxidoreductase Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
B4RTK8 2.28e-35 126 37 4 205 3 azoR FMN-dependent NADH:quinone oxidoreductase Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
A6U839 4.26e-35 125 36 3 200 3 azoR FMN-dependent NADH:quinone oxidoreductase Sinorhizobium medicae (strain WSM419)
A9H9I9 8.28e-35 125 39 4 203 3 azoR FMN-dependent NADH:quinone oxidoreductase Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / CCUG 37298 / CIP 103539 / LMG 7603 / PAl5)
Q3M1N6 8.73e-35 125 32 1 195 3 azoR1 FMN-dependent NADH:quinone oxidoreductase 1 Trichormus variabilis (strain ATCC 29413 / PCC 7937)
Q1MHV8 8.88e-35 125 36 3 203 3 azoR FMN-dependent NADH:quinone oxidoreductase Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q5QYY9 1.47e-34 124 36 4 200 3 azoR1 FMN-dependent NADH:quinone oxidoreductase 1 Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
B9MI46 2.02e-34 124 35 2 185 3 azoR FMN-dependent NADH:quinone oxidoreductase Acidovorax ebreus (strain TPSY)
Q0KBB2 3.49e-34 123 36 2 199 3 azoR FMN-dependent NADH:quinone oxidoreductase Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
A1W8C6 3.82e-34 123 35 2 185 3 azoR FMN-dependent NADH:quinone oxidoreductase Acidovorax sp. (strain JS42)
Q4ZS35 4.42e-34 123 36 4 202 3 azoR FMN-dependent NADH:quinone oxidoreductase Pseudomonas syringae pv. syringae (strain B728a)
Q215Z0 6.59e-34 122 35 2 203 3 azoR FMN-dependent NADH:quinone oxidoreductase Rhodopseudomonas palustris (strain BisB18)
A6VTC3 6.84e-34 122 35 2 199 3 azoR FMN-dependent NADH:quinone oxidoreductase Marinomonas sp. (strain MWYL1)
B8IER1 9.04e-34 122 35 4 206 3 azoR FMN-dependent NADH:quinone oxidoreductase Methylobacterium nodulans (strain LMG 21967 / CNCM I-2342 / ORS 2060)
Q3BNP7 1.58e-33 122 36 1 184 3 azoR2 FMN-dependent NADH:quinone oxidoreductase 2 Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
B0TWJ9 1.86e-33 121 34 4 205 3 azoR FMN-dependent NADH:quinone oxidoreductase Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
P58903 1.92e-33 122 37 1 182 3 azoR2 FMN-dependent NADH:quinone oxidoreductase 2 Xanthomonas axonopodis pv. citri (strain 306)
B5ZZC8 2.67e-33 121 35 4 203 3 azoR FMN-dependent NADH:quinone oxidoreductase Rhizobium leguminosarum bv. trifolii (strain WSM2304)
Q471X2 8.34e-33 120 35 2 199 3 azoR1 FMN-dependent NADH:quinone oxidoreductase 1 Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
C1D6X4 1.01e-32 119 34 3 186 3 azoR FMN-dependent NADH:quinone oxidoreductase Laribacter hongkongensis (strain HLHK9)
Q89K13 1.95e-32 119 35 3 205 3 azoR2 FMN-dependent NADH:quinone oxidoreductase 2 Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
B1ZKG7 2.77e-32 118 35 2 189 3 azoR FMN-dependent NADH:quinone oxidoreductase Methylorubrum populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001)
Q8UG34 3.74e-32 118 34 2 184 3 azoR FMN-dependent NADH:quinone oxidoreductase Agrobacterium fabrum (strain C58 / ATCC 33970)
C3MAW0 4.91e-32 117 35 4 200 3 azoR FMN-dependent NADH:quinone oxidoreductase Sinorhizobium fredii (strain NBRC 101917 / NGR234)
B7KYE7 5.63e-32 117 34 2 189 3 azoR FMN-dependent NADH:quinone oxidoreductase Methylorubrum extorquens (strain CM4 / NCIMB 13688)
Q98IF8 5.75e-32 117 32 2 185 3 azoR FMN-dependent NADH:quinone oxidoreductase Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q92E41 1.8e-31 116 35 3 191 3 azoR1 FMN-dependent NADH:quinone oxidoreductase 1 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q722T9 2.3e-31 116 33 4 203 3 azoR1 FMN-dependent NADH:quinone oxidoreductase 1 Listeria monocytogenes serotype 4b (strain F2365)
Q8Y9C1 3.01e-31 115 33 4 203 3 azoR1 FMN-dependent NADH:quinone oxidoreductase 1 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
B1M4X4 3.16e-31 115 35 4 205 3 azoR FMN-dependent NADH:quinone oxidoreductase Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831 / NBRC 15690 / NCIMB 10815 / 0-1)
A9W4C5 3.25e-31 115 33 2 189 3 azoR FMN-dependent NADH:quinone oxidoreductase Methylorubrum extorquens (strain PA1)
B8EJL7 5.23e-31 115 33 2 203 3 azoR FMN-dependent NADH:quinone oxidoreductase Methylocella silvestris (strain DSM 15510 / CIP 108128 / LMG 27833 / NCIMB 13906 / BL2)
Q81EX6 6.96e-31 115 33 4 206 3 azoR1 FMN-dependent NADH:quinone oxidoreductase 1 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q2SMF5 1.42e-30 114 36 2 178 3 azoR1 FMN-dependent NADH:quinone oxidoreductase 1 Hahella chejuensis (strain KCTC 2396)
Q63CP4 3.29e-30 113 33 4 206 3 azoR2 FMN-dependent NADH:quinone oxidoreductase 2 Bacillus cereus (strain ZK / E33L)
Q6HK44 3.29e-30 113 33 4 206 3 azoR1 FMN-dependent NADH:quinone oxidoreductase 1 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q739Z4 4.64e-30 112 33 4 206 3 azoR2 FMN-dependent NADH:quinone oxidoreductase 2 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q81RX7 5.94e-30 112 33 4 206 3 azoR2 FMN-dependent NADH:quinone oxidoreductase 2 Bacillus anthracis
Q65II8 8.74e-30 112 30 3 206 3 azoR1 FMN-dependent NADH:quinone oxidoreductase 1 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
A7IDY1 8.83e-30 112 35 3 188 3 azoR FMN-dependent NADH:quinone oxidoreductase Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)
A9C3B1 9.66e-30 112 41 1 130 3 azoR FMN-dependent NADH:quinone oxidoreductase Delftia acidovorans (strain DSM 14801 / SPH-1)
Q39M92 1.12e-29 111 34 2 186 3 azoR7 FMN-dependent NADH:quinone oxidoreductase 7 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
O35022 1.15e-29 112 29 3 206 2 azoR1 FMN-dependent NADH:quinone oxidoreductase 1 Bacillus subtilis (strain 168)
Q031U1 4.63e-29 110 36 3 178 3 azoR FMN-dependent NADH:quinone oxidoreductase Lactococcus lactis subsp. cremoris (strain SK11)
Q5FSL0 4.8e-29 110 34 6 207 3 azoR FMN-dependent NADH:quinone oxidoreductase Gluconobacter oxydans (strain 621H)
Q28UD5 6.13e-29 109 39 3 164 3 azoR1 FMN-dependent NADH:quinone oxidoreductase 1 Jannaschia sp. (strain CCS1)
Q831B2 6.41e-29 110 31 4 194 1 azoR FMN-dependent NADH:quinone oxidoreductase Enterococcus faecalis (strain ATCC 700802 / V583)
Q46W52 8.23e-29 109 32 4 192 3 azoR2 FMN-dependent NADH:quinone oxidoreductase 2 Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q65EW6 8.73e-29 109 33 3 175 3 azoR2 FMN-dependent NADH:quinone oxidoreductase 2 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
B5EGQ4 9.38e-29 109 32 2 183 3 azoR FMN-dependent NADH:quinone oxidoreductase Citrifermentans bemidjiense (strain ATCC BAA-1014 / DSM 16622 / JCM 12645 / Bem)
Q9CIH9 9.39e-29 109 36 3 178 3 azoR2 FMN-dependent NADH:quinone oxidoreductase 2 Lactococcus lactis subsp. lactis (strain IL1403)
P58904 2.12e-28 108 38 7 192 3 azoR FMN-dependent NADH:quinone oxidoreductase Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
A5EF62 3.5e-28 107 34 2 183 3 azoR FMN-dependent NADH:quinone oxidoreductase Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
B7GLH3 5.32e-28 107 33 2 175 3 azoR FMN-dependent NADH:quinone oxidoreductase Anoxybacillus flavithermus (strain DSM 21510 / WK1)
Q3SJT0 6.11e-28 107 35 4 195 3 azoR FMN-dependent NADH:quinone oxidoreductase Thiobacillus denitrificans (strain ATCC 25259)
Q2N970 9.35e-28 106 34 5 202 3 azoR FMN-dependent NADH:quinone oxidoreductase Erythrobacter litoralis (strain HTCC2594)
A4Z112 3.87e-27 105 33 3 181 3 azoR FMN-dependent NADH:quinone oxidoreductase Bradyrhizobium sp. (strain ORS 278)
Q0A5T4 4.12e-27 105 32 3 192 3 azoR FMN-dependent NADH:quinone oxidoreductase Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q63BV2 4.96e-27 105 32 4 209 3 azoR3 FMN-dependent NADH:quinone oxidoreductase 3 Bacillus cereus (strain ZK / E33L)
Q630J1 5.41e-27 105 30 3 192 3 azoR4 FMN-dependent NADH:quinone oxidoreductase 4 Bacillus cereus (strain ZK / E33L)
B9DKM7 5.96e-27 104 30 4 206 3 azoR FMN-dependent NADH:quinone oxidoreductase Staphylococcus carnosus (strain TM300)
B2IKT2 6.24e-27 104 29 3 202 3 azoR FMN-dependent NADH:quinone oxidoreductase Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIMB 8712)
Q81JP2 6.63e-27 104 29 3 192 1 azoR4 FMN-dependent NADH:quinone oxidoreductase 4 Bacillus anthracis
Q6HAM6 6.63e-27 104 29 3 192 3 azoR3 FMN-dependent NADH:quinone oxidoreductase 3 Bacillus thuringiensis subsp. konkukian (strain 97-27)
B3E8C4 7.18e-27 104 30 3 189 3 azoR FMN-dependent NADH:quinone oxidoreductase Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)
Q5KUC3 7.44e-27 104 30 3 200 3 azoR FMN-dependent NADH:quinone oxidoreductase Geobacillus kaustophilus (strain HTA426)
A6LU79 1.11e-26 103 31 3 203 3 azoR FMN-dependent NADH:quinone oxidoreductase Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
Q81R20 1.41e-26 103 33 7 211 3 azoR3 FMN-dependent NADH:quinone oxidoreductase 3 Bacillus anthracis
Q9X4K2 1.94e-26 103 30 2 184 3 azoR FMN-dependent NADH:quinone oxidoreductase Geobacillus stearothermophilus
Q6HJC2 2.62e-26 103 33 7 211 3 azoR2 FMN-dependent NADH:quinone oxidoreductase 2 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q738X4 2.82e-26 103 33 7 211 3 azoR3 FMN-dependent NADH:quinone oxidoreductase 3 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q81E02 3.17e-26 103 31 4 209 3 azoR2 FMN-dependent NADH:quinone oxidoreductase 2 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q9K5P5 3.84e-26 102 29 4 208 3 azoR3 FMN-dependent NADH:quinone oxidoreductase 3 Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q72X39 4.43e-26 102 29 3 192 3 azoR4 FMN-dependent NADH:quinone oxidoreductase 4 Bacillus cereus (strain ATCC 10987 / NRS 248)
C0ZIX8 4.52e-26 102 30 3 190 3 azoR FMN-dependent NADH:quinone oxidoreductase Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)
Q4L9I0 6.43e-26 102 30 5 184 3 azoR FMN-dependent NADH:quinone oxidoreductase Staphylococcus haemolyticus (strain JCSC1435)
Q8XM99 9.1e-26 101 29 3 198 3 azoR2 FMN-dependent NADH:quinone oxidoreductase 2 Clostridium perfringens (strain 13 / Type A)
Q39B00 1.11e-25 101 33 3 203 3 azoR1 FMN-dependent NADH:quinone oxidoreductase 1 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
B9E9A2 1.92e-25 100 30 4 208 3 azoR FMN-dependent NADH:quinone oxidoreductase Macrococcus caseolyticus (strain JCSC5402)
C1F513 2.02e-25 100 31 4 205 3 azoR FMN-dependent NADH:quinone oxidoreductase Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / BCRC 80197 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161)
Q0TSZ6 2.38e-25 100 29 3 198 3 azoR FMN-dependent NADH:quinone oxidoreductase Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Q92DN4 5.05e-25 100 34 5 187 3 azoR2 FMN-dependent NADH:quinone oxidoreductase 2 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q3KIU3 5.45e-25 99 30 3 196 3 azoR1 FMN-dependent NADH:quinone oxidoreductase 1 Pseudomonas fluorescens (strain Pf0-1)
A5GAC6 5.79e-25 99 30 3 193 3 azoR FMN-dependent NADH:quinone oxidoreductase Geotalea uraniireducens (strain Rf4)
Q722D2 8.51e-25 99 33 5 187 3 azoR2 FMN-dependent NADH:quinone oxidoreductase 2 Listeria monocytogenes serotype 4b (strain F2365)
Q8Y8V6 8.97e-25 99 33 5 187 3 azoR2 FMN-dependent NADH:quinone oxidoreductase 2 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q4KEN7 9.37e-25 99 29 3 200 3 azoR4 FMN-dependent NADH:quinone oxidoreductase 4 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
A8FA13 1.05e-24 99 30 2 191 3 azoR FMN-dependent NADH:quinone oxidoreductase Bacillus pumilus (strain SAFR-032)
Q814L8 1.46e-24 98 28 3 192 3 azoR3 FMN-dependent NADH:quinone oxidoreductase 3 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q0SUV5 2e-24 98 28 3 198 3 azoR FMN-dependent NADH:quinone oxidoreductase Clostridium perfringens (strain SM101 / Type A)
O32224 2.26e-24 98 30 2 175 1 azoR2 FMN-dependent NADH:quinone oxidoreductase 2 Bacillus subtilis (strain 168)
Q9KBG1 2.28e-24 98 32 3 186 3 azoR1 FMN-dependent NADH:quinone oxidoreductase 1 Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
A1VBA6 2.76e-24 98 31 3 208 3 azoR FMN-dependent NADH:quinone oxidoreductase Nitratidesulfovibrio vulgaris (strain DP4)
Q728Q5 2.76e-24 98 31 3 208 3 azoR FMN-dependent NADH:quinone oxidoreductase Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
A9KM25 3.34e-24 97 32 4 198 3 azoR FMN-dependent NADH:quinone oxidoreductase Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg)
Q2JFC9 3.39e-24 97 34 3 180 3 azoR FMN-dependent NADH:quinone oxidoreductase Frankia casuarinae (strain DSM 45818 / CECT 9043 / HFP020203 / CcI3)
Q5WB95 3.78e-24 97 31 2 190 3 azoR FMN-dependent NADH:quinone oxidoreductase Shouchella clausii (strain KSM-K16)
Q9CJ86 3.9e-24 97 28 3 204 3 azoR1 FMN-dependent NADH:quinone oxidoreductase 1 Lactococcus lactis subsp. lactis (strain IL1403)
B1ZNL9 5.03e-24 97 33 4 183 3 azoR FMN-dependent NADH:quinone oxidoreductase Opitutus terrae (strain DSM 11246 / JCM 15787 / PB90-1)
Q932K5 5.38e-24 97 28 4 206 3 azoR FMN-dependent NADH:quinone oxidoreductase Staphylococcus aureus (strain Mu50 / ATCC 700699)
A7WXK6 5.38e-24 97 28 4 206 3 azoR FMN-dependent NADH:quinone oxidoreductase Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q9I5F3 6.55e-24 97 28 4 204 1 azoR1 FMN-dependent NAD(P)H:quinone oxidoreductase 1 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q8NYK7 6.87e-24 97 30 4 183 3 azoR FMN-dependent NADH:quinone oxidoreductase Staphylococcus aureus (strain MW2)
Q6GCR4 6.87e-24 97 30 4 183 3 azoR FMN-dependent NADH:quinone oxidoreductase Staphylococcus aureus (strain MSSA476)
A8Z0H0 7.97e-24 96 30 4 183 3 azoR FMN-dependent NADH:quinone oxidoreductase Staphylococcus aureus (strain USA300 / TCH1516)
Q99X11 7.97e-24 96 30 4 183 1 azoR FMN-dependent NADH:quinone oxidoreductase Staphylococcus aureus (strain N315)
Q5HJG8 7.97e-24 96 30 4 183 3 azoR FMN-dependent NADH:quinone oxidoreductase Staphylococcus aureus (strain COL)
Q2YV20 7.97e-24 96 30 4 183 3 azoR FMN-dependent NADH:quinone oxidoreductase Staphylococcus aureus (strain bovine RF122 / ET3-1)
A5IP80 7.97e-24 96 30 4 183 3 azoR FMN-dependent NADH:quinone oxidoreductase Staphylococcus aureus (strain JH9)
Q2G1F2 7.97e-24 96 30 4 183 3 azoR FMN-dependent NADH:quinone oxidoreductase Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FK58 7.97e-24 96 30 4 183 3 azoR FMN-dependent NADH:quinone oxidoreductase Staphylococcus aureus (strain USA300)
A6TXZ6 7.97e-24 96 30 4 183 3 azoR FMN-dependent NADH:quinone oxidoreductase Staphylococcus aureus (strain JH1)
A7Z8S7 1.79e-23 95 29 2 175 3 azoR FMN-dependent NADH:quinone oxidoreductase Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
Q390D0 6.14e-23 94 30 3 185 3 azoR5 FMN-dependent NADH:quinone oxidoreductase 5 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q2SGY7 1.33e-22 93 31 3 166 3 azoR2 FMN-dependent NADH:quinone oxidoreductase 2 Hahella chejuensis (strain KCTC 2396)
Q0RRM3 1.92e-22 93 30 3 180 3 azoR FMN-dependent NADH:quinone oxidoreductase Frankia alni (strain DSM 45986 / CECT 9034 / ACN14a)
Q97DQ1 2e-22 92 31 7 207 3 azoR2 FMN-dependent NADH:quinone oxidoreductase 2 Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q6GKA4 2.37e-22 92 28 4 183 3 azoR FMN-dependent NADH:quinone oxidoreductase Staphylococcus aureus (strain MRSA252)
Q88Y41 3.06e-22 92 32 3 181 3 azoR2 FMN-dependent NADH:quinone oxidoreductase 2 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
A4XJK7 3.41e-22 92 31 6 205 3 azoR FMN-dependent NADH:quinone oxidoreductase Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331)
Q9K672 3.54e-22 92 29 4 196 3 azoR2 FMN-dependent NADH:quinone oxidoreductase 2 Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q484U8 3.66e-22 92 31 3 179 3 azoR1 FMN-dependent NADH:quinone oxidoreductase 1 Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
B9KUU6 3.84e-22 92 30 2 188 3 azoR FMN-dependent NADH:quinone oxidoreductase Cereibacter sphaeroides (strain KD131 / KCTC 12085)
A8LAY7 4.34e-22 92 30 3 177 3 azoR FMN-dependent NADH:quinone oxidoreductase Parafrankia sp. (strain EAN1pec)
A3PQD8 6.53e-22 91 30 2 181 3 azoR FMN-dependent NADH:quinone oxidoreductase Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
Q0BTA0 6.74e-22 91 29 4 208 3 azoR FMN-dependent NADH:quinone oxidoreductase Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1)
Q3IVU8 1.11e-21 90 30 2 181 3 azoR FMN-dependent NADH:quinone oxidoreductase Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
B5Y659 3.77e-21 89 30 6 206 3 azoR FMN-dependent NADH:quinone oxidoreductase Coprothermobacter proteolyticus (strain ATCC 35245 / DSM 5265 / OCM 4 / BT)
Q2K196 6.75e-21 89 32 5 188 3 azoR2 FMN-dependent NADH:quinone oxidoreductase 2 Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
C4L0W8 8.89e-21 89 28 2 189 3 azoR FMN-dependent NADH:quinone oxidoreductase Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b)
Q39M29 1.88e-20 88 31 6 199 3 azoR8 FMN-dependent NADH:quinone oxidoreductase 8 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q28QS5 3.46e-20 87 31 5 189 3 azoR2 FMN-dependent NADH:quinone oxidoreductase 2 Jannaschia sp. (strain CCS1)
B9MQS8 3.77e-20 87 31 7 206 3 azoR FMN-dependent NADH:quinone oxidoreductase Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / KCTC 15123 / Z-1320)
A4W2Z7 4.95e-20 86 29 4 182 3 azoR FMN-dependent NADH:quinone oxidoreductase Streptococcus suis (strain 98HAH33)
A8I0R2 5.28e-20 86 33 5 192 3 azoR FMN-dependent NADH:quinone oxidoreductase Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
Q4KJ26 2.09e-19 85 28 5 211 3 azoR1 FMN-dependent NADH:quinone oxidoreductase 1 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q63F37 2.46e-19 85 28 7 212 3 azoR1 FMN-dependent NADH:quinone oxidoreductase 1 Bacillus cereus (strain ZK / E33L)
Q81UB2 3.67e-19 84 29 4 172 1 azoR1 FMN-dependent NADH:quinone oxidoreductase 1 Bacillus anthracis
Q4FMI9 1.03e-18 83 28 6 202 3 azoR FMN-dependent NADH:quinone oxidoreductase Pelagibacter ubique (strain HTCC1062)
Q394J5 1.26e-18 83 28 3 184 3 azoR3 FMN-dependent NADH:quinone oxidoreductase 3 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q39M02 1.99e-18 82 28 2 191 3 azoR9 FMN-dependent NADH:quinone oxidoreductase 9 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q9S1U6 2.13e-18 82 32 4 181 3 azoR FMN-dependent NADH:quinone oxidoreductase Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
C0ZT83 2.22e-18 82 29 4 181 3 azoR FMN-dependent NADH:quinone oxidoreductase Rhodococcus erythropolis (strain PR4 / NBRC 100887)
Q73CJ5 7.56e-18 81 29 4 172 3 azoR1 FMN-dependent NADH:quinone oxidoreductase 1 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q5R0V3 1.17e-17 81 28 7 218 3 azoR2 FMN-dependent NADH:quinone oxidoreductase 2 Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q4KF31 2e-17 80 27 3 191 3 azoR3 FMN-dependent NADH:quinone oxidoreductase 3 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q6ALS1 2.71e-17 79 30 6 210 3 azoR FMN-dependent NADH:quinone oxidoreductase Desulfotalea psychrophila (strain LSv54 / DSM 12343)
Q82FB5 4.35e-15 73 33 6 161 3 azoR FMN-dependent NADH:quinone oxidoreductase Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q8E1T4 5e-15 73 25 4 194 3 azoR FMN-dependent NADH:quinone oxidoreductase Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8E797 5e-15 73 25 4 194 3 azoR FMN-dependent NADH:quinone oxidoreductase Streptococcus agalactiae serotype III (strain NEM316)
Q3K3B0 5e-15 73 25 4 194 3 azoR FMN-dependent NADH:quinone oxidoreductase Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q89PW2 6.32e-15 73 30 5 180 3 azoR1 FMN-dependent NADH:quinone oxidoreductase 1 Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q5YR63 1.5e-14 72 29 5 182 3 azoR FMN-dependent NADH:quinone oxidoreductase Nocardia farcinica (strain IFM 10152)
Q6MUK2 2.01e-14 71 31 5 152 3 azoR FMN-dependent NADH:quinone oxidoreductase Mycoplasma mycoides subsp. mycoides SC (strain CCUG 32753 / NCTC 10114 / PG1)
Q2ST93 3.03e-14 71 32 6 150 3 azoR FMN-dependent NADH:quinone oxidoreductase Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154)
Q47ZU7 5.04e-14 71 23 3 193 3 azoR2 FMN-dependent NADH:quinone oxidoreductase 2 Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
B3PM20 8.38e-13 67 34 6 148 3 azoR FMN-dependent NADH:quinone oxidoreductase Metamycoplasma arthritidis (strain 158L3-1)
Q5LXG9 2.63e-12 66 26 3 179 3 azoR FMN-dependent NADH:quinone oxidoreductase Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
Q890E7 1.54e-11 64 30 2 129 3 azoR1 FMN-dependent NADH:quinone oxidoreductase 1 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q87UC3 3.5e-11 63 25 5 180 3 azoR2 FMN-dependent NADH:quinone oxidoreductase 2 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
P47575 5.13e-11 62 28 8 183 3 azoR FMN-dependent NADH:quinone oxidoreductase Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
Q97LF7 9.09e-11 62 24 3 184 3 azoR1 FMN-dependent NADH:quinone oxidoreductase 1 Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
A6W4I5 1.43e-10 61 30 5 149 3 azoR FMN-dependent NADH:quinone oxidoreductase Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216)
Q6F271 2.47e-10 60 29 5 148 3 azoR1 FMN-dependent NADH:quinone oxidoreductase 1 Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1)
Q6KHU1 1.58e-09 58 31 5 150 3 azoR FMN-dependent NADH:quinone oxidoreductase Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711)
B2V3P0 1.98e-09 58 24 5 210 3 azoR FMN-dependent NADH:quinone oxidoreductase Clostridium botulinum (strain Alaska E43 / Type E3)
Q6LFW5 3.34e-09 57 33 5 119 3 azoR2 FMN-dependent NADH:quinone oxidoreductase 2 Photobacterium profundum (strain SS9)
B2TRR9 3.4e-09 57 24 5 210 3 azoR FMN-dependent NADH:quinone oxidoreductase Clostridium botulinum (strain Eklund 17B / Type B)
Q98QP9 9.09e-09 56 25 6 204 3 azoR FMN-dependent NADH:quinone oxidoreductase Mycoplasmopsis pulmonis (strain UAB CTIP)
P75305 1.25e-08 55 26 4 146 3 azoR FMN-dependent NADH:quinone oxidoreductase Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
Q8EWL4 2.86e-08 55 28 6 150 3 azoR FMN-dependent NADH:quinone oxidoreductase Malacoplasma penetrans (strain HF-2)
B8I799 3.36e-08 55 23 5 212 3 azoR FMN-dependent NADH:quinone oxidoreductase Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10)
Q7NAW1 4.61e-08 54 30 7 152 3 azoR FMN-dependent NADH:quinone oxidoreductase Mycoplasmoides gallisepticum (strain R(low / passage 15 / clone 2))
Q6F265 1.52e-07 53 30 6 153 3 azoR2 FMN-dependent NADH:quinone oxidoreductase 2 Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1)
Q4A6W2 1.1e-06 50 28 6 148 3 azoR FMN-dependent NADH:quinone oxidoreductase Mycoplasmopsis synoviae (strain 53)
Q399J3 1.74e-05 47 22 4 200 3 azoR2 FMN-dependent NADH:quinone oxidoreductase 2 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
A0A481WNM5 5.66e-05 46 29 2 84 3 traD Ribosyldihydronicotinamide dehydrogenase-like protein traD Penicillium crustosum
Q4A9N3 8.96e-05 45 28 7 167 3 azoR FMN-dependent NADH:quinone oxidoreductase Mesomycoplasma hyopneumoniae (strain J / ATCC 25934 / NCTC 10110)
Q4A7R7 0.000353 43 28 7 167 3 azoR FMN-dependent NADH:quinone oxidoreductase Mesomycoplasma hyopneumoniae (strain 7448)

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_02360
Feature type CDS
Gene azoR
Product FMN-dependent NADH-azoreductase
Location 161784 - 162389 (strand: -1)
Length 606 (nucleotides) / 201 (amino acids)
In genomic island -

Contig

Accession contig_2
Length 292399 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_232
Orthogroup size 8
N. genomes 7

Actions

Genomic region

Domains

PF02525 Flavodoxin-like fold

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1182 Energy production and conversion (C) C FMN-dependent NADH-azoreductase

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K01118 FMN-dependent NADH-azoreductase [EC:1.7.1.17] - -

Protein Sequence

MQKVLVLKSSILADYSHTNKMADYFIGQWRKNHADDAITVRDLSADPVPVLDNEIVSGMHGSAGGTLTQRQESANALQTELIDELFAHDVIVFTAPMYNFTIPTQLKTYLDFIAAAGKTFRYTEKGAEGLVTGKRAIVLTARGGFHRDQTSDLIVPFMTQFLGFIGISDIEFIYAEGVSMGEDFAEKAQQNARQCVEALSA

Flanking regions ( +/- flanking 50bp)

ATACACTGATTACGTAATAAATAAGCTGAATCACAATAACAAGGTTTACTATGCAAAAAGTTCTCGTTCTGAAATCCAGTATTCTTGCGGACTACTCACACACCAACAAAATGGCGGATTATTTTATCGGACAATGGCGGAAAAATCATGCAGATGATGCGATCACTGTCCGCGACCTGAGTGCTGACCCGGTACCGGTTCTGGATAACGAAATTGTTTCCGGTATGCATGGTTCCGCAGGCGGCACCTTAACACAGCGTCAGGAGTCCGCAAATGCATTACAGACTGAACTGATTGATGAGCTTTTTGCACACGACGTTATCGTATTCACCGCACCAATGTATAACTTCACCATACCGACACAGCTGAAAACCTATCTGGATTTCATTGCAGCTGCCGGCAAGACCTTCCGCTATACCGAAAAAGGTGCCGAAGGGCTGGTGACGGGCAAACGTGCGATTGTTCTGACTGCACGCGGCGGTTTCCACCGCGATCAGACGTCTGACCTGATTGTGCCGTTTATGACACAGTTCCTGGGTTTTATCGGGATCAGCGATATTGAGTTTATTTATGCCGAAGGTGTCTCGATGGGTGAGGATTTTGCTGAAAAAGCACAGCAGAATGCCCGTCAGTGCGTTGAAGCGCTTTCCGCATAACCGGATAACAACACAAAAACAAGCAGTATCATCATTAATCATCCTTGTTC