Homologs in group_3689

Help

3 homologs were identified in 2 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
F4V73_RS06955 F4V73_RS06955 50.0 Morganella psychrotolerans - PAAR domain-containing protein
PMI_RS19585 PMI_RS19585 92.3 Proteus mirabilis HI4320 - RHS domain-containing protein
PMI_RS05220 PMI_RS05220 84.6 Proteus mirabilis HI4320 - PAAR domain-containing protein

Distribution of the homologs in the orthogroup group_3689

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3689

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS19600
Feature type CDS
Gene -
Product hypothetical protein
Location 1137577 - 1137813 (strand: -1)
Length 237 (nucleotides) / 78 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_3689
Orthogroup size 4
N. genomes 2

Actions

Genomic region

Protein Sequence

MVESRAHGTLKRHETHFVWQGLRLLQEQDINTGKCQTYCYEEHSSYTPLAVIVKQSSVFHYYWHHCDINSAPLEVTNA

Flanking regions ( +/- flanking 50bp)

AGATATCAGCACTTTGAAATAACAATGCACTGGGTCGCCGGATTCATAAAGTGGTTGAGTCACGGGCTCACGGCACACTGAAACGACATGAAACCCATTTTGTGTGGCAAGGACTACGGTTGCTGCAAGAGCAGGATATCAATACGGGTAAATGTCAGACCTATTGCTACGAAGAACACAGCAGTTATACCCCACTCGCCGTTATCGTGAAGCAATCCAGTGTTTTTCATTATTACTGGCATCACTGCGATATTAACAGTGCCCCACTTGAAGTCACCAATGCATAAGGCAATACGCTATGGTCAGGAAAATATGAACGCTTTGGTTTTGTTCGCAA