Homologs in group_121

Help

10 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_06220 FBDBKF_06220 15.9 Morganella morganii S1 thiQ thiamine ABC transporter ATP-binding protein ThiQ
EHELCC_09265 EHELCC_09265 15.9 Morganella morganii S2 thiQ thiamine ABC transporter ATP-binding protein ThiQ
NLDBIP_09645 NLDBIP_09645 15.9 Morganella morganii S4 thiQ thiamine ABC transporter ATP-binding protein ThiQ
LHKJJB_08110 LHKJJB_08110 15.9 Morganella morganii S3 thiQ thiamine ABC transporter ATP-binding protein ThiQ
HKOGLL_07660 HKOGLL_07660 15.9 Morganella morganii S5 thiQ thiamine ABC transporter ATP-binding protein ThiQ
F4V73_RS15695 F4V73_RS15695 14.8 Morganella psychrotolerans thiQ thiamine ABC transporter ATP-binding protein ThiQ
PMI_RS04640 PMI_RS04640 38.8 Proteus mirabilis HI4320 - AAA family ATPase
PMI_RS05675 PMI_RS05675 14.5 Proteus mirabilis HI4320 fetA iron ABC transporter ATP-binding protein FetA
PMI_RS06995 PMI_RS06995 26.9 Proteus mirabilis HI4320 - ATP-binding protein
PMI_RS11495 PMI_RS11495 21.6 Proteus mirabilis HI4320 thiQ thiamine ABC transporter ATP-binding protein ThiQ

Distribution of the homologs in the orthogroup group_121

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_121

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P03754 2.51e-15 75 33 0 96 4 ea59 Protein ea59 Escherichia phage lambda

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS19510
Feature type CDS
Gene -
Product AAA family ATPase
Location 369937 - 370389 (strand: -1)
Length 453 (nucleotides) / 150 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_121
Orthogroup size 11
N. genomes 7

Actions

Genomic region

Domains

PF13175 AAA ATPase domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3593 Replication, recombination and repair (L) L Predicted ATP-dependent endonuclease of the OLD family, contains P-loop ATPase and TOPRIM domains

Protein Sequence

MTEIIANIRYDSLIIFDEPETHLHPNAISQLINSIHSLADQFKSYCIIAPHSPIIVQGILSKNIFVIKNENKVLSVTHPSLETFGENLSKITDDIFGARDTPQYFRKKIEDQIKIGYSIDDIRKSIQSDGVPLSLNLSILLQNMEIKNND

Flanking regions ( +/- flanking 50bp)

AAAATCAATAAAAAAAATTAAGCTCAGGGCAAGCTATTTTCTTATATATTATGACTGAAATTATTGCTAATATAAGATATGACTCATTAATAATTTTTGATGAACCAGAAACACACTTACACCCTAATGCCATATCTCAGTTAATTAATAGCATTCACTCTCTTGCTGATCAATTTAAATCTTACTGTATAATAGCACCCCATTCTCCAATTATTGTTCAAGGGATTTTATCTAAAAATATTTTTGTCATAAAAAATGAAAATAAAGTATTAAGTGTAACACATCCATCGCTGGAAACATTTGGTGAAAACTTGTCAAAAATTACTGATGATATTTTCGGTGCGAGAGATACACCACAATATTTTAGAAAAAAAATAGAAGATCAAATTAAAATTGGATATAGTATTGATGATATTAGAAAATCCATTCAATCTGATGGAGTTCCTCTTAGTTTAAATCTTTCCATTTTATTACAAAACATGGAGATCAAAAATAATGATTAACTTAACTCCATATTCTGATTCTAGTATCTCTTTTTTACGTTCAATTATTA