Homologs in group_299

Help

7 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_07915 FBDBKF_07915 31.4 Morganella morganii S1 fbpC ferric ABC transporter ATP-binding protein
EHELCC_13745 EHELCC_13745 31.4 Morganella morganii S2 fbpC ferric ABC transporter ATP-binding protein
NLDBIP_14190 NLDBIP_14190 31.4 Morganella morganii S4 fbpC ferric ABC transporter ATP-binding protein
LHKJJB_08660 LHKJJB_08660 31.4 Morganella morganii S3 fbpC ferric ABC transporter ATP-binding protein
HKOGLL_08210 HKOGLL_08210 31.4 Morganella morganii S5 fbpC ferric ABC transporter ATP-binding protein
F4V73_RS13070 F4V73_RS13070 31.9 Morganella psychrotolerans fbpC ferric ABC transporter ATP-binding protein
PMI_RS00905 PMI_RS00905 31.9 Proteus mirabilis HI4320 fbpC ferric ABC transporter ATP-binding protein

Distribution of the homologs in the orthogroup group_299

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_299

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P77279 7.89e-97 284 66 0 213 1 fetA Probable iron export ATP-binding protein FetA Escherichia coli (strain K12)
Q5L222 1.42e-31 120 32 4 211 3 potA Spermidine/putrescine import ATP-binding protein PotA Geobacillus kaustophilus (strain HTA426)
Q8RCU0 5.01e-31 116 37 3 199 3 pstB1 Phosphate import ATP-binding protein PstB 1 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
G7CBF6 1.8e-30 120 36 5 213 1 irtB Mycobactin import ATP-binding/permease protein IrtB Mycolicibacterium thermoresistibile (strain ATCC 19527 / DSM 44167 / CIP 105390 / JCM 6362 / NCTC 10409 / 316)
Q2YAD6 3.67e-30 117 37 4 198 3 potA Spermidine/putrescine import ATP-binding protein PotA Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
Q0AGF4 7.68e-30 116 36 4 198 3 potA Spermidine/putrescine import ATP-binding protein PotA Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
P9WQJ7 9.73e-30 118 37 4 205 1 irtB Mycobactin import ATP-binding/permease protein IrtB Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQJ6 9.73e-30 118 37 4 205 3 irtB Mycobactin import ATP-binding/permease protein IrtB Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P63394 9.73e-30 118 37 4 205 3 irtB Mycobactin import ATP-binding/permease protein IrtB Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q0I2Z4 4.29e-29 114 34 7 212 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Histophilus somni (strain 129Pt)
O34756 6.07e-29 111 35 2 188 3 yjkB Putative ABC transporter ATP-binding protein YjkB Bacillus subtilis (strain 168)
Q6F0V4 8.23e-29 113 35 5 203 3 potA Spermidine/putrescine import ATP-binding protein PotA Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1)
Q14Q07 8.76e-29 113 37 5 197 3 potA Spermidine/putrescine import ATP-binding protein PotA Spiroplasma citri
A0R6H7 1.14e-28 115 37 5 200 1 irtB Mycobactin import ATP-binding/permease protein IrtB Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q830W6 2.04e-28 112 36 5 207 3 potA Spermidine/putrescine import ATP-binding protein PotA Enterococcus faecalis (strain ATCC 700802 / V583)
Q9CM80 2.6e-28 112 33 7 212 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Pasteurella multocida (strain Pm70)
Q1WVI7 2.74e-28 112 36 5 197 3 potA Spermidine/putrescine import ATP-binding protein PotA Ligilactobacillus salivarius (strain UCC118)
Q6MU19 2.82e-28 112 34 5 211 3 potA Spermidine/putrescine import ATP-binding protein PotA Mycoplasma mycoides subsp. mycoides SC (strain CCUG 32753 / NCTC 10114 / PG1)
Q58762 3.41e-28 110 39 7 184 3 wtpC Molybdate/tungstate import ATP-binding protein WtpC Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q2SSS4 3.89e-28 111 34 5 211 3 potA Spermidine/putrescine import ATP-binding protein PotA Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154)
Q65S66 6.21e-28 111 33 6 211 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
A3DJK5 8.45e-28 109 34 3 191 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
Q5NN23 1.06e-27 108 38 7 211 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
Q8H1R4 1.17e-27 108 33 5 206 1 ABCI10 ABC transporter I family member 10 Arabidopsis thaliana
P44531 2.17e-27 109 33 7 212 3 fbpC1 Fe(3+) ions import ATP-binding protein FbpC 1 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q660M8 2.25e-27 109 34 4 189 3 potA Spermidine/putrescine import ATP-binding protein PotA Borrelia garinii subsp. bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi)
O51587 2.47e-27 109 34 4 189 3 potA Spermidine/putrescine import ATP-binding protein PotA Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31)
Q57293 2.5e-27 109 33 7 212 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Actinobacillus pleuropneumoniae
Q1GIE5 3.28e-27 109 38 6 193 3 potA Spermidine/putrescine import ATP-binding protein PotA Ruegeria sp. (strain TM1040)
Q7W9U5 3.52e-27 109 36 5 193 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WGW1 4.55e-27 108 36 5 193 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q9C9W0 7.6e-27 106 34 0 193 2 ABCI17 ABC transporter I family member 17 Arabidopsis thaliana
Q7VZE5 7.71e-27 108 35 4 194 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q0SML1 1.01e-26 107 34 4 189 3 potA Spermidine/putrescine import ATP-binding protein PotA Borreliella afzelii (strain PKo)
Q3KCC5 1.08e-26 107 32 3 185 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Pseudomonas fluorescens (strain Pf0-1)
A0A348AXX9 1.66e-26 110 33 7 215 2 kk1G ABC-type transporter kk1G Curvularia clavata
A0A348AXX9 8.05e-11 64 25 10 260 2 kk1G ABC-type transporter kk1G Curvularia clavata
Q5FL41 1.99e-26 107 36 3 185 3 potA Spermidine/putrescine import ATP-binding protein PotA Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
Q7NQN5 2.82e-26 107 32 4 214 3 potA Spermidine/putrescine import ATP-binding protein PotA Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q6LKD4 2.89e-26 106 31 4 208 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Photobacterium profundum (strain SS9)
Q74K65 3.08e-26 107 35 3 185 3 potA Spermidine/putrescine import ATP-binding protein PotA Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Q58903 3.79e-26 103 32 5 197 3 MJ1508 Uncharacterized ABC transporter ATP-binding protein MJ1508 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q6NBT1 3.89e-26 106 36 5 185 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
A3DDF6 3.91e-26 106 32 5 214 3 potA Spermidine/putrescine import ATP-binding protein PotA Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
Q8DUF7 5.12e-26 106 35 4 197 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q8RI39 5.19e-26 106 37 8 203 3 potA Spermidine/putrescine import ATP-binding protein PotA Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q5E586 5.24e-26 106 32 4 210 3 potA Spermidine/putrescine import ATP-binding protein PotA Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q0S0Z3 6.52e-26 105 33 4 189 3 fbpC2 Fe(3+) ions import ATP-binding protein FbpC 2 Rhodococcus jostii (strain RHA1)
P37009 7.37e-26 105 32 4 207 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Escherichia coli (strain K12)
Q0RYP7 9.66e-26 105 34 4 182 3 fbpC3 Fe(3+) ions import ATP-binding protein FbpC 3 Rhodococcus jostii (strain RHA1)
Q88ZJ6 9.91e-26 105 36 4 190 3 potA Spermidine/putrescine import ATP-binding protein PotA Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q042G7 1.15e-25 105 35 3 185 3 potA Spermidine/putrescine import ATP-binding protein PotA Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / BCRC 14619 / CIP 102991 / JCM 1131 / KCTC 3163 / NCIMB 11718 / NCTC 13722 / AM63)
Q7AH43 1.18e-25 105 32 4 207 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Escherichia coli O157:H7
Q9KLQ5 1.21e-25 105 30 4 205 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P34712 1.24e-25 107 33 6 193 1 pgp-1 Multidrug resistance protein pgp-1 Caenorhabditis elegans
P34712 8.31e-18 84 30 4 193 1 pgp-1 Multidrug resistance protein pgp-1 Caenorhabditis elegans
Q5JEB0 1.26e-25 104 34 3 190 3 wtpC Molybdate/tungstate import ATP-binding protein WtpC Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
Q9C7F8 1.29e-25 107 31 6 213 3 ABCB13 ABC transporter B family member 13 Arabidopsis thaliana
Q9C7F8 1.07e-21 96 32 4 196 3 ABCB13 ABC transporter B family member 13 Arabidopsis thaliana
Q8ELR4 1.38e-25 105 31 6 214 3 potA Spermidine/putrescine import ATP-binding protein PotA Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q9X196 1.74e-25 105 36 4 192 3 potA Spermidine/putrescine import ATP-binding protein PotA Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q6LPK2 1.93e-25 102 32 7 219 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Photobacterium profundum (strain SS9)
P0A9S0 1.95e-25 101 34 5 191 3 ftsE Cell division ATP-binding protein FtsE Shigella flexneri
P0A9R7 1.95e-25 101 34 5 191 1 ftsE Cell division ATP-binding protein FtsE Escherichia coli (strain K12)
P0A9R8 1.95e-25 101 34 5 191 3 ftsE Cell division ATP-binding protein FtsE Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0A9R9 1.95e-25 101 34 5 191 3 ftsE Cell division ATP-binding protein FtsE Escherichia coli O157:H7
A0A0H2ZLL3 2.12e-25 102 33 4 200 3 egtUA Probable ergothioneine transport ATP-binding protein EgtUA Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q85A69 2.15e-25 104 34 4 192 2 cysA Sulfate/thiosulfate import ATP-binding protein CysA Anthoceros angustus
Q6D2F6 2.23e-25 104 29 4 206 3 fbpC2 Fe(3+) ions import ATP-binding protein FbpC 2 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
P36619 2.35e-25 106 30 4 204 3 pmd1 Leptomycin B resistance protein pmd1 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
P36619 3.18e-19 89 31 4 194 3 pmd1 Leptomycin B resistance protein pmd1 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q45460 3.34e-25 104 32 4 198 2 opuBA Choline transport ATP-binding protein OpuBA Bacillus subtilis (strain 168)
Q38VW6 3.38e-25 103 36 6 205 3 potA Spermidine/putrescine import ATP-binding protein PotA Latilactobacillus sakei subsp. sakei (strain 23K)
Q4L8L7 4.23e-25 100 33 5 198 3 hrtA Putative hemin import ATP-binding protein HrtA Staphylococcus haemolyticus (strain JCSC1435)
Q7NWX3 5.24e-25 103 34 5 189 3 cysA2 Sulfate/thiosulfate import ATP-binding protein CysA 2 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
A0A095C325 5.28e-25 105 34 6 200 1 MDR1 ABC multidrug transporter MDR1 Cryptococcus deuterogattii (strain R265)
A0A095C325 1.6e-17 84 28 6 225 1 MDR1 ABC multidrug transporter MDR1 Cryptococcus deuterogattii (strain R265)
Q2SJY7 5.33e-25 103 32 4 205 3 potA Spermidine/putrescine import ATP-binding protein PotA Hahella chejuensis (strain KCTC 2396)
Q6NJ07 5.5e-25 103 34 4 195 3 metN Methionine import ATP-binding protein MetN Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
Q9Y7M7 5.84e-25 105 30 4 213 3 mdl1 ATP-dependent permease MDL1, mitochondrial Schizosaccharomyces pombe (strain 972 / ATCC 24843)
O34392 6e-25 100 34 4 183 2 ytrE ABC transporter ATP-binding protein YtrE Bacillus subtilis (strain 168)
Q9KHT9 6.38e-25 103 34 4 194 1 opuCA Carnitine transport ATP-binding protein OpuCA Listeria monocytogenes
G2JZ44 6.38e-25 103 34 4 194 1 opuCA Carnitine transport ATP-binding protein OpuCA Listeria monocytogenes serotype 1/2a (strain 10403S)
Q6D734 6.77e-25 103 30 4 213 3 fbpC1 Fe(3+) ions import ATP-binding protein FbpC 1 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q7NX01 7.57e-25 103 34 6 201 3 cysA1 Sulfate/thiosulfate import ATP-binding protein CysA 1 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q0SBZ1 7.98e-25 102 33 4 189 3 fbpC1 Fe(3+) ions import ATP-binding protein FbpC 1 Rhodococcus jostii (strain RHA1)
Q9YGA6 8.24e-25 103 31 5 195 1 malK Trehalose/maltose import ATP-binding protein MalK Thermococcus litoralis (strain ATCC 51850 / DSM 5473 / JCM 8560 / NS-C)
Q3ATY5 8.43e-25 100 35 7 220 3 lolD1 Lipoprotein-releasing system ATP-binding protein LolD 1 Chlorobium chlorochromatii (strain CaD3)
Q8NSN2 8.69e-25 102 35 7 201 3 metN Methionine import ATP-binding protein MetN Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
O57896 9.67e-25 102 35 4 181 3 wtpC Molybdate/tungstate import ATP-binding protein WtpC Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
J9VF33 9.96e-25 104 34 6 200 1 MDR1 ABC multidrug transporter MDR1 Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487)
J9VF33 3.22e-18 85 29 6 228 1 MDR1 ABC multidrug transporter MDR1 Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487)
Q9MUN1 1.02e-24 102 35 5 190 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Mesostigma viride
O83658 1.06e-24 102 37 7 195 3 potA Spermidine/putrescine import ATP-binding protein PotA Treponema pallidum (strain Nichols)
O34992 1.11e-24 102 32 4 198 1 opuCA Glycine betaine/carnitine/choline transport ATP-binding protein OpuCA Bacillus subtilis (strain 168)
Q8FRX8 1.12e-24 102 34 6 200 3 metN Methionine import ATP-binding protein MetN Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
Q7N6Z2 1.26e-24 102 34 6 195 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q88AS5 1.3e-24 102 34 6 193 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q5L5Z1 1.41e-24 102 32 5 213 3 metN Methionine import ATP-binding protein MetN Chlamydia abortus (strain DSM 27085 / S26/3)
Q82TL6 1.47e-24 102 34 4 198 3 potA Spermidine/putrescine import ATP-binding protein PotA Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q8KF76 1.49e-24 99 36 5 200 3 lolD1 Lipoprotein-releasing system ATP-binding protein LolD 1 Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
Q0BFQ0 1.55e-24 101 34 4 203 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
Q0P9C4 1.7e-24 103 32 6 218 1 pglK Protein glycosylation K Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Q3B276 1.78e-24 99 35 7 218 3 lolD2 Lipoprotein-releasing system ATP-binding protein LolD 2 Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530)
Q98HF7 1.89e-24 102 36 5 196 3 potA Spermidine/putrescine import ATP-binding protein PotA Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
P10089 1.94e-24 103 32 3 203 3 hlyB Alpha-hemolysin translocation ATP-binding protein HlyB Escherichia coli
Q9I6L0 1.96e-24 101 34 4 193 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q73F67 2.03e-24 100 34 6 213 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus cereus (strain ATCC 10987 / NRS 248)
P08716 2.06e-24 103 32 3 203 1 hlyB Alpha-hemolysin translocation ATP-binding protein HlyB Escherichia coli
Q1CJS9 2.16e-24 101 33 6 206 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Yersinia pestis bv. Antiqua (strain Nepal516)
Q8ZCM2 2.16e-24 101 33 6 206 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Yersinia pestis
Q1C607 2.16e-24 101 33 6 206 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Yersinia pestis bv. Antiqua (strain Antiqua)
Q668Q3 2.19e-24 101 33 6 206 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Yersinia pseudotuberculosis serotype I (strain IP32953)
Q1WSB9 2.24e-24 100 34 7 210 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Ligilactobacillus salivarius (strain UCC118)
Q8FDZ8 2.24e-24 103 32 3 203 1 hlyB Alpha-hemolysin translocation ATP-binding protein HlyB Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q5PBX2 2.31e-24 99 33 4 200 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Anaplasma marginale (strain St. Maries)
Q9G4F5 2.31e-24 101 34 6 193 3 CYSA Sulfate/thiosulfate import ATP-binding protein cysA Cucumis sativus
Q47258 2.33e-24 103 32 3 203 1 hlyB Alpha-hemolysin translocation ATP-binding protein HlyB Escherichia coli
Q0I3C2 2.71e-24 99 37 5 186 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Histophilus somni (strain 129Pt)
G5EG61 2.76e-24 103 32 5 197 2 pgp-14 P-glycoprotein 14 Caenorhabditis elegans
G5EG61 2.86e-19 89 30 8 220 2 pgp-14 P-glycoprotein 14 Caenorhabditis elegans
Q03PY5 2.91e-24 100 31 6 211 1 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
Q4QK57 3.04e-24 101 31 5 211 3 potA Spermidine/putrescine import ATP-binding protein PotA Haemophilus influenzae (strain 86-028NP)
Q4A5A5 3.06e-24 99 32 3 190 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Mycoplasmopsis synoviae (strain 53)
Q93DX8 3.21e-24 99 34 6 199 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA (Fragment) Burkholderia cepacia
Q57554 3.25e-24 99 33 4 209 3 MJ0089 Uncharacterized ABC transporter ATP-binding protein MJ0089 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
P45171 3.27e-24 101 31 5 211 3 potA Spermidine/putrescine import ATP-binding protein PotA Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q9Y8G1 3.35e-24 103 29 3 204 1 atrD ABC multidrug transporter atrD Emericella nidulans
Q9Y8G1 2.49e-21 95 31 6 202 1 atrD ABC multidrug transporter atrD Emericella nidulans
Q0I3Y9 3.58e-24 101 31 4 200 3 potA Spermidine/putrescine import ATP-binding protein PotA Histophilus somni (strain 129Pt)
Q5BAY0 4.02e-24 103 29 3 204 1 atrD ABC multidrug transporter atrD Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Q5BAY0 2.99e-21 94 31 6 202 1 atrD ABC multidrug transporter atrD Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Q65T42 4.59e-24 100 35 6 199 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q1QE80 4.89e-24 101 30 2 208 3 potA Spermidine/putrescine import ATP-binding protein PotA Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
F2T1C4 4.91e-24 102 29 5 204 1 MDR2 ABC multidrug transporter MDR2 Trichophyton rubrum (strain ATCC MYA-4607 / CBS 118892)
F2T1C4 1.05e-22 99 33 5 193 1 MDR2 ABC multidrug transporter MDR2 Trichophyton rubrum (strain ATCC MYA-4607 / CBS 118892)
Q81ZF5 4.91e-24 100 34 3 185 3 metN2 Methionine import ATP-binding protein MetN 2 Bacillus anthracis
Q9KS33 5.1e-24 101 31 5 213 3 potA Spermidine/putrescine import ATP-binding protein PotA Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q8U4K3 5.26e-24 100 32 4 181 3 wtpC Molybdate/tungstate import ATP-binding protein WtpC Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
Q7N8B9 5.26e-24 100 30 4 204 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q6HP89 5.33e-24 100 34 3 185 3 metN1 Methionine import ATP-binding protein MetN 1 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q7MKU3 5.76e-24 100 32 5 215 3 potA Spermidine/putrescine import ATP-binding protein PotA Vibrio vulnificus (strain YJ016)
Q8D9J4 5.76e-24 100 32 5 215 3 potA Spermidine/putrescine import ATP-binding protein PotA Vibrio vulnificus (strain CMCP6)
Q58967 5.81e-24 99 36 7 201 3 MJ1572 Putative ABC transporter ATP-binding protein MJ1572 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q92DL6 5.96e-24 100 33 5 192 3 potA Spermidine/putrescine import ATP-binding protein PotA Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q1GB17 6.1e-24 100 34 3 185 3 potA Spermidine/putrescine import ATP-binding protein PotA Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / BCRC 10696 / JCM 1002 / NBRC 13953 / NCIMB 11778 / NCTC 12712 / WDCM 00102 / Lb 14)
Q1BWL4 7.04e-24 99 34 4 203 3 ssuB1 Aliphatic sulfonates import ATP-binding protein SsuB 1 Burkholderia orbicola (strain AU 1054)
A0K739 7.04e-24 99 34 4 203 3 ssuB1 Aliphatic sulfonates import ATP-binding protein SsuB 1 Burkholderia cenocepacia (strain HI2424)
A0A1U9YI12 8.92e-24 102 29 3 203 2 verA ABC-type transmembrane transporter verA Clonostachys rogersoniana
A0A1U9YI12 2.84e-16 80 31 5 197 2 verA ABC-type transmembrane transporter verA Clonostachys rogersoniana
A0PY57 9.23e-24 100 33 5 187 3 potA Spermidine/putrescine import ATP-binding protein PotA Clostridium novyi (strain NT)
Q6D201 9.36e-24 99 35 6 196 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q5HC57 1.04e-23 97 31 4 199 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Ehrlichia ruminantium (strain Welgevonden)
Q5FFC0 1.04e-23 97 31 4 199 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Ehrlichia ruminantium (strain Gardel)
Q81IN8 1.05e-23 99 34 3 185 3 metN2 Methionine import ATP-binding protein MetN 2 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q8XZP8 1.25e-23 100 34 5 196 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q9V2C0 1.26e-23 99 35 4 184 3 wtpC Molybdate/tungstate import ATP-binding protein WtpC Pyrococcus abyssi (strain GE5 / Orsay)
Q6F9A8 1.27e-23 99 33 5 194 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
F2RP52 1.28e-23 101 29 5 204 2 MDR2 ABC multidrug transporter MDR2 Trichophyton tonsurans (strain CBS 112818)
F2RP52 1.66e-22 98 33 5 193 2 MDR2 ABC multidrug transporter MDR2 Trichophyton tonsurans (strain CBS 112818)
A0A059JJ46 1.28e-23 101 29 5 204 2 MDR2 ABC multidrug transporter MDR2 Trichophyton interdigitale (strain MR816)
A0A059JJ46 1.05e-22 99 33 5 193 2 MDR2 ABC multidrug transporter MDR2 Trichophyton interdigitale (strain MR816)
F2PRR1 1.28e-23 101 29 5 204 2 MDR2 ABC multidrug transporter MDR2 Trichophyton equinum (strain ATCC MYA-4606 / CBS 127.97)
F2PRR1 1.66e-22 98 33 5 193 2 MDR2 ABC multidrug transporter MDR2 Trichophyton equinum (strain ATCC MYA-4606 / CBS 127.97)
Q81J16 1.32e-23 98 33 6 213 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q54BU4 1.34e-23 101 31 3 193 3 abcB1 ABC transporter B family member 1 Dictyostelium discoideum
A0AGP9 1.45e-23 99 34 6 193 3 potA Spermidine/putrescine import ATP-binding protein PotA Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
Q722B1 1.49e-23 99 34 6 193 3 potA Spermidine/putrescine import ATP-binding protein PotA Listeria monocytogenes serotype 4b (strain F2365)
Q8Y8T6 1.51e-23 99 34 6 193 3 potA Spermidine/putrescine import ATP-binding protein PotA Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q63GR8 1.6e-23 99 34 3 185 3 metN2 Methionine import ATP-binding protein MetN 2 Bacillus cereus (strain ZK / E33L)
Q9C7F2 1.63e-23 101 30 5 213 3 ABCB14 ABC transporter B family member 14 Arabidopsis thaliana
Q9C7F2 8.92e-19 87 28 4 197 3 ABCB14 ABC transporter B family member 14 Arabidopsis thaliana
Q81GC1 1.72e-23 99 31 3 206 3 potA Spermidine/putrescine import ATP-binding protein PotA Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q0D9V6 1.74e-23 99 33 0 173 1 STAR1 Protein STAR1 Oryza sativa subsp. japonica
Q00449 1.91e-23 101 33 5 196 2 Mdr49 Multidrug resistance protein homolog 49 Drosophila melanogaster
Q00449 9.26e-17 81 28 5 207 2 Mdr49 Multidrug resistance protein homolog 49 Drosophila melanogaster
A0LUE6 1.98e-23 99 31 4 193 3 potA Spermidine/putrescine import ATP-binding protein PotA Acidothermus cellulolyticus (strain ATCC 43068 / DSM 8971 / 11B)
Q18AM3 2.01e-23 99 36 4 190 3 potA Spermidine/putrescine import ATP-binding protein PotA Clostridioides difficile (strain 630)
Q1CDR0 2.07e-23 97 34 6 202 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Yersinia pestis bv. Antiqua (strain Nepal516)
Q74PI5 2.07e-23 97 34 6 202 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Yersinia pestis
Q1C1S0 2.07e-23 97 34 6 202 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Yersinia pestis bv. Antiqua (strain Antiqua)
Q04BG2 2.12e-23 99 34 3 185 3 potA Spermidine/putrescine import ATP-binding protein PotA Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365 / Lb-18)
Q89UD2 2.12e-23 99 34 5 192 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q9CP06 2.16e-23 99 33 4 208 3 potA Spermidine/putrescine import ATP-binding protein PotA Pasteurella multocida (strain Pm70)
O34946 2.28e-23 96 31 6 222 1 znuC High-affinity zinc uptake system ATP-binding protein ZnuC Bacillus subtilis (strain 168)
Q0RAT5 2.33e-23 100 34 4 191 3 potA Spermidine/putrescine import ATP-binding protein PotA Frankia alni (strain DSM 45986 / CECT 9034 / ACN14a)
Q0SRL2 2.4e-23 99 36 4 190 3 potA Spermidine/putrescine import ATP-binding protein PotA Clostridium perfringens (strain SM101 / Type A)
P26760 2.45e-23 100 32 3 197 1 apxIB Toxin RTX-I translocation ATP-binding protein Actinobacillus pleuropneumoniae
Q73EL7 2.49e-23 98 34 3 185 3 metN2 Methionine import ATP-binding protein MetN 2 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q6HPN0 2.59e-23 97 33 6 213 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q81VQ2 2.59e-23 97 33 6 213 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus anthracis
A0R8K8 2.59e-23 97 33 6 213 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus thuringiensis (strain Al Hakam)
Q6A6X6 2.69e-23 99 32 4 186 3 metN Methionine import ATP-binding protein MetN Cutibacterium acnes (strain DSM 16379 / KPA171202)
Q2M3G0 2.71e-23 100 32 3 199 1 ABCB5 ATP-binding cassette sub-family B member 5 Homo sapiens
Q2M3G0 3.57e-22 97 30 4 202 1 ABCB5 ATP-binding cassette sub-family B member 5 Homo sapiens
Q63H62 2.79e-23 97 33 6 213 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Bacillus cereus (strain ZK / E33L)
Q30V33 3.07e-23 99 34 4 187 3 potA Spermidine/putrescine import ATP-binding protein PotA Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
Q65UE1 3.13e-23 99 34 5 190 3 potA Spermidine/putrescine import ATP-binding protein PotA Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q87PH3 3.24e-23 99 33 5 208 3 potA Spermidine/putrescine import ATP-binding protein PotA Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q67JX4 3.41e-23 97 31 6 193 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
Q160M2 3.46e-23 98 34 3 192 3 potA Spermidine/putrescine import ATP-binding protein PotA Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
Q1LNM0 3.47e-23 97 35 6 202 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
P10091 3.75e-23 98 37 8 209 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Marchantia polymorpha
Q39GW5 3.78e-23 97 34 4 203 3 ssuB1 Aliphatic sulfonates import ATP-binding protein SsuB 1 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q03518 4.34e-23 100 29 3 198 1 TAP1 Antigen peptide transporter 1 Homo sapiens
Q8D0W8 4.42e-23 98 33 5 201 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Yersinia pestis
P9WQM1 4.46e-23 98 35 4 183 1 cysA Sulfate/thiosulfate import ATP-binding protein CysA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQM0 4.46e-23 98 35 4 183 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0A4W3 4.46e-23 98 35 4 183 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q47C66 4.53e-23 95 31 4 196 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Dechloromonas aromatica (strain RCB)
Q64SQ6 4.98e-23 99 31 4 211 3 potA Spermidine/putrescine import ATP-binding protein PotA Bacteroides fragilis (strain YCH46)
Q8ETV7 5.01e-23 96 30 4 213 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q3K9F9 5.19e-23 95 33 5 201 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Pseudomonas fluorescens (strain Pf0-1)
Q5LBT4 5.29e-23 99 31 4 211 3 potA Spermidine/putrescine import ATP-binding protein PotA Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
Q2LVL0 5.43e-23 99 30 4 207 3 msbA ATP-dependent lipid A-core flippase Syntrophus aciditrophicus (strain SB)
Q668K6 5.53e-23 98 33 5 201 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Yersinia pseudotuberculosis serotype I (strain IP32953)
Q28433 5.84e-23 99 29 3 198 2 TAP1 Antigen peptide transporter 1 Gorilla gorilla gorilla
Q92VJ2 6.02e-23 98 33 4 193 3 cysA2 Sulfate/thiosulfate import ATP-binding protein CysA 2 Rhizobium meliloti (strain 1021)
Q9YG51 6.4e-23 95 30 4 205 3 pstB Phosphate import ATP-binding protein PstB Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1)
Q110U3 6.52e-23 98 31 5 204 3 potA Spermidine/putrescine import ATP-binding protein PotA Trichodesmium erythraeum (strain IMS101)
Q02R79 6.57e-23 97 33 4 181 3 potA Spermidine/putrescine import ATP-binding protein PotA Pseudomonas aeruginosa (strain UCBPP-PA14)
Q9HY19 6.64e-23 97 33 4 181 3 potA2 Spermidine/putrescine import ATP-binding protein PotA 2 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q1B677 7.09e-23 97 31 6 200 3 metN Methionine import ATP-binding protein MetN Mycobacterium sp. (strain MCS)
Q8XIZ5 7.63e-23 97 35 4 190 3 potA Spermidine/putrescine import ATP-binding protein PotA Clostridium perfringens (strain 13 / Type A)
Q0TNZ3 7.63e-23 97 35 4 190 3 potA Spermidine/putrescine import ATP-binding protein PotA Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Q6HLQ9 7.78e-23 97 30 3 206 3 potA Spermidine/putrescine import ATP-binding protein PotA Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q665B6 7.88e-23 96 34 6 202 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Yersinia pseudotuberculosis serotype I (strain IP32953)
Q63E84 8.53e-23 97 30 3 206 3 potA Spermidine/putrescine import ATP-binding protein PotA Bacillus cereus (strain ZK / E33L)
Q73BM0 8.53e-23 97 30 3 206 3 potA Spermidine/putrescine import ATP-binding protein PotA Bacillus cereus (strain ATCC 10987 / NRS 248)
A0RBB0 8.53e-23 97 30 3 206 3 potA Spermidine/putrescine import ATP-binding protein PotA Bacillus thuringiensis (strain Al Hakam)
Q49WM4 9.48e-23 97 33 4 207 3 potA Spermidine/putrescine import ATP-binding protein PotA Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q81TH8 1.06e-22 96 31 3 206 3 potA Spermidine/putrescine import ATP-binding protein PotA Bacillus anthracis
P16676 1.07e-22 97 33 5 201 1 cysA Sulfate/thiosulfate import ATP-binding protein CysA Escherichia coli (strain K12)
Q8FFB3 1.14e-22 97 33 5 201 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q8XBJ8 1.15e-22 97 33 5 201 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Escherichia coli O157:H7
O34314 1.17e-22 95 34 4 189 3 ytlC Uncharacterized ABC transporter ATP-binding protein YtlC Bacillus subtilis (strain 168)
Q5ZWE4 1.22e-22 97 32 4 195 3 potA Spermidine/putrescine import ATP-binding protein PotA Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Q8DZJ0 1.23e-22 97 33 5 199 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8E554 1.23e-22 97 33 5 199 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus agalactiae serotype III (strain NEM316)
Q3K0Y6 1.23e-22 97 33 5 199 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q4WTT9 1.24e-22 99 32 5 194 2 mdr1 ABC multidrug transporter mdr1 Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
Q4WTT9 9.03e-22 96 28 4 204 2 mdr1 ABC multidrug transporter mdr1 Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
Q24XJ2 1.26e-22 97 33 5 197 3 potA Spermidine/putrescine import ATP-binding protein PotA Desulfitobacterium hafniense (strain Y51)
Q7UC29 1.29e-22 97 33 5 201 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Shigella flexneri
Q8RGC8 1.29e-22 97 33 4 193 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q5X627 1.3e-22 97 33 5 195 3 potA Spermidine/putrescine import ATP-binding protein PotA Legionella pneumophila (strain Paris)
Q8CPN0 1.34e-22 97 31 4 207 3 potA Spermidine/putrescine import ATP-binding protein PotA Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q6KHL1 1.36e-22 95 31 3 214 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711)
O85818 1.42e-22 97 32 5 211 3 potA Spermidine/putrescine import ATP-binding protein PotA Aggregatibacter actinomycetemcomitans
Q87EF0 1.46e-22 98 31 7 201 3 msbA ATP-dependent lipid A-core flippase Xylella fastidiosa (strain Temecula1 / ATCC 700964)
Q5FA19 1.49e-22 96 32 6 193 1 fbpC Fe(3+) ions import ATP-binding protein FbpC Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
B5X0E4 1.51e-22 98 29 4 206 2 Abcb5 ATP-binding cassette sub-family B member 5 Mus musculus
B5X0E4 1.59e-21 95 30 2 197 2 Abcb5 ATP-binding cassette sub-family B member 5 Mus musculus
Q9NP78 1.56e-22 98 31 4 196 1 ABCB9 ABC-type oligopeptide transporter ABCB9 Homo sapiens
Q2L219 1.62e-22 94 32 4 196 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Bordetella avium (strain 197N)
P21449 1.66e-22 98 31 6 192 2 PGY2 Multidrug resistance protein 2 Cricetulus griseus
P21449 5.15e-22 97 30 6 196 2 PGY2 Multidrug resistance protein 2 Cricetulus griseus
Q63TY1 1.68e-22 96 33 4 198 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Burkholderia pseudomallei (strain K96243)
Q9A502 1.72e-22 96 32 4 194 3 metN Methionine import ATP-binding protein MetN Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q3JSR6 1.79e-22 96 32 4 204 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Burkholderia pseudomallei (strain 1710b)
Q62K82 1.82e-22 96 33 4 198 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Burkholderia mallei (strain ATCC 23344)
Q48KI4 1.9e-22 94 30 5 201 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q8RY46 2.03e-22 98 32 5 203 1 ABCB26 ABC transporter B family member 26, chloroplastic Arabidopsis thaliana
Q4WD46 2.07e-22 98 31 4 191 2 fsqE ABC-type transporter fsqE Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
Q4WD46 4.31e-17 82 31 6 222 2 fsqE ABC-type transporter fsqE Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
P23702 2.12e-22 98 32 4 204 1 ltxB Leukotoxin export ATP-binding protein LtxB Aggregatibacter actinomycetemcomitans
Q63TW1 2.22e-22 95 32 4 204 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Burkholderia pseudomallei (strain K96243)
P40860 2.27e-22 96 32 5 201 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P16875 2.33e-22 98 32 4 195 3 MDR1 Multidrug resistance protein 1 Entamoeba histolytica (strain ATCC 30459 / HM-1:IMSS / ABRM)
P16875 5.56e-19 88 30 3 195 3 MDR1 Multidrug resistance protein 1 Entamoeba histolytica (strain ATCC 30459 / HM-1:IMSS / ABRM)
Q92WJ0 2.41e-22 96 33 6 198 3 fbpC1 Fe(3+) ions import ATP-binding protein FbpC 1 Rhizobium meliloti (strain 1021)
Q62K56 2.41e-22 95 32 4 204 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Burkholderia mallei (strain ATCC 23344)
P21448 2.53e-22 97 31 6 192 1 ABCB1 ATP-dependent translocase ABCB1 Cricetulus griseus
P21448 1.58e-21 95 30 6 196 1 ABCB1 ATP-dependent translocase ABCB1 Cricetulus griseus
Q4PH16 2.59e-22 97 33 8 208 3 ATM1 Iron-sulfur clusters transporter ATM1, mitochondrial Ustilago maydis (strain 521 / FGSC 9021)
Q8Z4V6 2.67e-22 96 32 5 201 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Salmonella typhi
P54718 2.72e-22 97 36 6 196 3 yfiB Uncharacterized ABC transporter ATP-binding protein YfiB Bacillus subtilis (strain 168)
Q823C4 2.86e-22 95 33 4 208 3 metN Methionine import ATP-binding protein MetN Chlamydia caviae (strain ATCC VR-813 / DSM 19441 / 03DC25 / GPIC)
Q7VNG4 3.09e-22 96 33 4 184 3 potA Spermidine/putrescine import ATP-binding protein PotA Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q8A883 3.32e-22 97 31 4 215 3 potA Spermidine/putrescine import ATP-binding protein PotA Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
Q5WXF0 3.48e-22 95 32 4 195 3 potA Spermidine/putrescine import ATP-binding protein PotA Legionella pneumophila (strain Lens)
P33311 3.57e-22 97 30 2 196 1 MDL2 ATP-dependent permease MDL2, mitochondrial Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q8UH62 3.57e-22 95 32 5 201 3 cysA1 Sulfate/thiosulfate import ATP-binding protein CysA 1 Agrobacterium fabrum (strain C58 / ATCC 33970)
Q8XXB6 3.72e-22 97 29 8 223 3 msbA ATP-dependent lipid A-core flippase Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q4KFA2 3.79e-22 93 30 5 201 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
P45247 3.87e-22 93 34 5 186 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q4QKQ9 3.87e-22 93 34 5 186 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Haemophilus influenzae (strain 86-028NP)
Q48QM2 4.01e-22 94 30 6 211 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M28 (strain MGAS6180)
Q1JJC9 4.01e-22 94 30 6 211 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M12 (strain MGAS9429)
P0C0E8 4.01e-22 94 30 6 211 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M1
P0C0E9 4.27e-22 94 30 6 211 3 ecfA Energy-coupling factor transporter ATP-binding protein EcfA Streptococcus pyogenes
P0CZ29 4.27e-22 94 30 6 211 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M3 (strain SSI-1)
A2RH11 4.27e-22 94 30 6 211 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M5 (strain Manfredo)
Q1J449 4.27e-22 94 30 6 211 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q1JEC8 4.27e-22 94 30 6 211 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q7CMM7 4.27e-22 94 30 6 211 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q5X9B5 4.27e-22 94 30 6 211 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P0CZ28 4.27e-22 94 30 6 211 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
P21958 4.42e-22 97 28 5 221 1 Tap1 Antigen peptide transporter 1 Mus musculus
Q5LT05 4.44e-22 95 34 4 193 3 potA Spermidine/putrescine import ATP-binding protein PotA Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
Q9NRK6 4.48e-22 97 32 5 195 1 ABCB10 ATP-binding cassette sub-family B member 10, mitochondrial Homo sapiens
Q8PP41 4.49e-22 93 33 6 212 3 ssuB1 Aliphatic sulfonates import ATP-binding protein SsuB 1 Xanthomonas axonopodis pv. citri (strain 306)
Q5RFQ9 4.53e-22 97 35 4 169 2 ABCB8 Mitochondrial potassium channel ATP-binding subunit Pongo abelii
A1TXH7 4.63e-22 95 31 4 209 3 potA Spermidine/putrescine import ATP-binding protein PotA Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q5HQ70 4.91e-22 95 30 4 207 3 potA Spermidine/putrescine import ATP-binding protein PotA Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
O32151 5.01e-22 95 31 4 209 3 yurJ Uncharacterized ABC transporter ATP-binding protein YurJ Bacillus subtilis (strain 168)
Q44613 5.14e-22 93 33 6 216 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q1J982 5.36e-22 94 30 6 211 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus pyogenes serotype M12 (strain MGAS2096)
Q884I3 5.54e-22 92 29 5 201 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q3IX40 5.62e-22 95 31 4 182 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
Q9EYM2 5.83e-22 92 32 5 197 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
P23174 6.12e-22 96 31 6 192 2 ABCB4 Phosphatidylcholine translocator ABCB4 Cricetulus griseus
P23174 2.81e-20 92 30 6 196 2 ABCB4 Phosphatidylcholine translocator ABCB4 Cricetulus griseus
Q9PEE7 6.55e-22 96 31 7 201 3 msbA ATP-dependent lipid A-core flippase Xylella fastidiosa (strain 9a5c)
Q8Z0H0 6.62e-22 94 31 4 202 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q4ZZR8 6.71e-22 94 33 6 195 3 metN1 Methionine import ATP-binding protein MetN 1 Pseudomonas syringae pv. syringae (strain B728a)
Q98DT6 7.62e-22 93 31 5 209 3 ssuB1 Aliphatic sulfonates import ATP-binding protein SsuB 1 Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q08201 7.77e-22 96 31 7 193 1 Abcb4 Phosphatidylcholine translocator ABCB4 Rattus norvegicus
Q08201 5.64e-21 94 30 6 196 1 Abcb4 Phosphatidylcholine translocator ABCB4 Rattus norvegicus
Q9NUT2 8.19e-22 96 35 4 169 1 ABCB8 Mitochondrial potassium channel ATP-binding subunit Homo sapiens
Q6CX96 8.3e-22 96 30 4 207 3 ATM1 Iron-sulfur clusters transporter ATM1, mitochondrial Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37)
Q98G43 8.46e-22 94 32 6 184 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q9FNU2 8.79e-22 96 29 5 217 2 ABCB25 ABC transporter B family member 25 Oryza sativa subsp. japonica
Q3M5J9 8.88e-22 92 32 6 201 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Trichormus variabilis (strain ATCC 29413 / PCC 7937)
Q65VG9 9.48e-22 94 34 4 194 3 metN Methionine import ATP-binding protein MetN Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
P63354 9.94e-22 94 34 6 194 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Brucella suis biovar 1 (strain 1330)
P63353 9.94e-22 94 34 6 194 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q87UN4 9.99e-22 94 33 6 195 3 metN2 Methionine import ATP-binding protein MetN 2 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
P16877 1e-21 96 31 4 196 3 MDR4 Multidrug resistance protein 4 Entamoeba histolytica (strain ATCC 30459 / HM-1:IMSS / ABRM)
P16877 7.06e-18 85 28 4 212 3 MDR4 Multidrug resistance protein 4 Entamoeba histolytica (strain ATCC 30459 / HM-1:IMSS / ABRM)
Q88WA5 1e-21 94 33 4 189 3 metN1 Methionine import ATP-binding protein MetN 1 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
P33310 1.01e-21 95 31 5 202 1 MDL1 ATP-dependent permease MDL1, mitochondrial Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P44513 1.03e-21 94 30 6 212 1 fbpC2 Fe(3+) ions import ATP-binding protein FbpC 2 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q88CL2 1.1e-21 94 33 6 193 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q9PPV1 1.12e-21 93 30 3 212 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Ureaplasma parvum serovar 3 (strain ATCC 700970)
Q04473 1.18e-21 95 31 5 209 3 apxIIIB Toxin RTX-III translocation ATP-binding protein Actinobacillus pleuropneumoniae
Q4ZV73 1.22e-21 92 30 5 201 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Pseudomonas syringae pv. syringae (strain B728a)
Q1B8V9 1.23e-21 94 29 3 211 3 potA Spermidine/putrescine import ATP-binding protein PotA Mycobacterium sp. (strain MCS)
A1UG51 1.23e-21 94 29 3 211 3 potA Spermidine/putrescine import ATP-binding protein PotA Mycobacterium sp. (strain KMS)
A3CMQ7 1.25e-21 94 32 4 199 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus sanguinis (strain SK36)
P14788 1.3e-21 94 32 6 218 2 cysA Sulfate/thiosulfate import ATP-binding protein CysA Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q5LI72 1.33e-21 91 30 5 211 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
Q48PU6 1.36e-21 94 33 6 195 3 metN1 Methionine import ATP-binding protein MetN 1 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q47T99 1.4e-21 94 31 6 217 3 potA Spermidine/putrescine import ATP-binding protein PotA Thermobifida fusca (strain YX)
Q839D5 1.41e-21 92 30 3 195 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Enterococcus faecalis (strain ATCC 700802 / V583)
Q4QP85 1.44e-21 94 30 6 212 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Haemophilus influenzae (strain 86-028NP)
P77737 1.45e-21 94 31 5 198 1 oppF Oligopeptide transport ATP-binding protein OppF Escherichia coli (strain K12)
Q64Z80 1.47e-21 91 30 5 211 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Bacteroides fragilis (strain YCH46)
Q0AU85 1.5e-21 94 34 4 194 3 metN Methionine import ATP-binding protein MetN Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
Q669P3 1.51e-21 92 34 4 183 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Yersinia pseudotuberculosis serotype I (strain IP32953)
P56344 1.55e-21 92 31 3 195 3 cysA Probable sulfate/thiosulfate import ATP-binding protein CysA Chlorella vulgaris
Q8YBN5 1.58e-21 93 32 4 200 3 BMEII0864 Putative peptide import ATP-binding protein BMEII0864 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q8FWP2 1.58e-21 93 32 4 200 3 BRA0404 Putative peptide import ATP-binding protein BRA0404/BS1330_II0401 Brucella suis biovar 1 (strain 1330)
Q2YK62 1.58e-21 93 32 4 200 3 BAB2_0818 Putative peptide import ATP-binding protein BAB2_0818 Brucella abortus (strain 2308)
Q577J4 1.58e-21 93 32 4 200 3 BruAb2_0797 Putative peptide import ATP-binding protein BruAb2_0797 Brucella abortus biovar 1 (strain 9-941)
A5VU86 1.58e-21 93 32 4 200 3 BOV_A0347 Putative peptide import ATP-binding protein BOV_A0347 Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
P08183 1.62e-21 95 31 5 192 1 ABCB1 ATP-dependent translocase ABCB1 Homo sapiens
P08183 8.61e-20 90 29 6 196 1 ABCB1 ATP-dependent translocase ABCB1 Homo sapiens
P54933 1.69e-21 93 28 5 207 3 smoK ATP-binding transport protein SmoK Cereibacter sphaeroides
P75370 1.7e-21 92 30 8 222 3 p29 Probable ABC transporter ATP-binding protein p29 Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
P36370 1.77e-21 95 29 4 198 1 Tap1 Antigen peptide transporter 1 Rattus norvegicus
Q88RL5 1.82e-21 93 35 6 182 3 metN1 Methionine import ATP-binding protein MetN 1 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q7WID6 1.85e-21 94 31 4 182 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q6MCV4 1.86e-21 94 30 4 204 3 potA Spermidine/putrescine import ATP-binding protein PotA Protochlamydia amoebophila (strain UWE25)
Q7VYN2 1.96e-21 94 31 4 182 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q46717 1.97e-21 95 29 3 197 3 hlyB Alpha-hemolysin translocation ATP-binding protein HlyB Escherichia coli O157:H7
Q2SZW0 1.97e-21 95 29 3 202 3 msbA ATP-dependent lipid A-core flippase Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q1CI46 1.98e-21 91 34 4 183 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Yersinia pestis bv. Antiqua (strain Nepal516)
Q8ZFR4 1.98e-21 91 34 4 183 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Yersinia pestis
Q1C6Q8 1.98e-21 91 34 4 183 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Yersinia pestis bv. Antiqua (strain Antiqua)
Q73XU8 1.98e-21 94 33 4 193 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
P21447 1.99e-21 95 30 6 196 1 Abcb1a ATP-dependent translocase ABCB1 Mus musculus
P21447 9.18e-21 93 30 6 192 1 Abcb1a ATP-dependent translocase ABCB1 Mus musculus
Q9CN78 2.01e-21 91 33 4 183 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Pasteurella multocida (strain Pm70)
Q9HZL7 2.06e-21 91 31 5 197 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q12C33 2.16e-21 95 27 3 203 3 msbA ATP-dependent lipid A-core flippase Polaromonas sp. (strain JS666 / ATCC BAA-500)
Q2K8C8 2.18e-21 93 33 5 189 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q56A55 2.22e-21 95 33 4 191 2 abcb8 Mitochondrial potassium channel ATP-binding subunit Danio rerio
Q97ZT9 2.23e-21 92 30 6 214 3 pstB Phosphate import ATP-binding protein PstB Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
Q21XJ9 2.25e-21 92 33 6 204 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Q87R20 2.29e-21 91 32 4 196 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q72PP0 2.31e-21 91 33 5 195 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
Q7CN92 2.33e-21 94 33 5 201 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q99ZS8 2.33e-21 94 33 5 201 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M1
Q8D653 2.34e-21 93 33 6 194 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Vibrio vulnificus (strain CMCP6)
Q8F6L8 2.41e-21 91 33 5 195 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q8G5P8 2.48e-21 94 34 4 187 3 metN Methionine import ATP-binding protein MetN Bifidobacterium longum (strain NCC 2705)
P0A2U7 2.52e-21 91 29 6 214 3 adcC Zinc transport system ATP-binding protein AdcC Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P0A2U6 2.52e-21 91 29 6 214 3 adcC Zinc transport system ATP-binding protein AdcC Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q9ZR72 2.65e-21 95 31 6 216 1 ABCB1 ABC transporter B family member 1 Arabidopsis thaliana
Q9ZR72 4.5e-20 91 32 5 174 1 ABCB1 ABC transporter B family member 1 Arabidopsis thaliana
P16876 2.76e-21 95 31 4 196 3 MDR3 Multidrug resistance protein 3 Entamoeba histolytica (strain ATCC 30459 / HM-1:IMSS / ABRM)
P16876 5.61e-18 85 28 4 210 3 MDR3 Multidrug resistance protein 3 Entamoeba histolytica (strain ATCC 30459 / HM-1:IMSS / ABRM)
P08007 2.76e-21 93 32 5 198 1 oppF Oligopeptide transport ATP-binding protein OppF Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q4W575 2.78e-21 93 31 6 193 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q9JVH1 2.78e-21 93 31 6 193 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
P21439 2.78e-21 94 31 6 192 1 ABCB4 Phosphatidylcholine translocator ABCB4 Homo sapiens
P21439 4.91e-19 88 29 7 203 1 ABCB4 Phosphatidylcholine translocator ABCB4 Homo sapiens
Q60AI1 2.87e-21 93 34 5 186 3 potA Spermidine/putrescine import ATP-binding protein PotA Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q1D382 2.91e-21 90 31 5 185 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Myxococcus xanthus (strain DK1622)
Q9CHL8 3.08e-21 94 30 6 201 1 lmrA Multidrug resistance ABC transporter ATP-binding and permease protein Lactococcus lactis subsp. lactis (strain IL1403)
Q88XV2 3.26e-21 92 29 3 197 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q65TB7 3.4e-21 90 36 5 188 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q1J6Q6 3.52e-21 93 33 5 201 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q1JGY7 3.52e-21 93 33 5 201 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q1JLT7 3.52e-21 93 33 5 201 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1JBV6 3.52e-21 93 33 5 201 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M12 (strain MGAS2096)
Q6D4E2 3.56e-21 93 33 6 198 3 potA Spermidine/putrescine import ATP-binding protein PotA Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q9KL04 3.59e-21 93 33 5 195 3 malK Maltose/maltodextrin import ATP-binding protein MalK Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q03A07 3.68e-21 92 31 6 214 3 metN Methionine import ATP-binding protein MetN Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
Q5ZT78 3.74e-21 90 33 4 194 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Q20ZS6 3.74e-21 90 33 5 195 3 lolD2 Lipoprotein-releasing system ATP-binding protein LolD 2 Rhodopseudomonas palustris (strain BisB18)
Q5X2Z8 3.94e-21 90 34 4 196 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Legionella pneumophila (strain Paris)
Q1IGZ0 4.03e-21 92 31 6 204 3 metN2 Methionine import ATP-binding protein MetN 2 Pseudomonas entomophila (strain L48)
Q1MQ44 4.14e-21 93 31 4 203 3 potA Spermidine/putrescine import ATP-binding protein PotA Lawsonia intracellularis (strain PHE/MN1-00)
Q667L9 4.3e-21 92 33 5 206 3 metN2 Methionine import ATP-binding protein MetN 2 Yersinia pseudotuberculosis serotype I (strain IP32953)
A3PRY1 4.46e-21 92 30 4 182 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
Q7W6G5 4.49e-21 92 33 4 171 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q03ZQ0 4.63e-21 92 30 4 207 3 potA Spermidine/putrescine import ATP-binding protein PotA Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
Q5XCA4 4.71e-21 93 34 5 191 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
Q4K681 4.76e-21 92 33 4 196 3 potA Spermidine/putrescine import ATP-binding protein PotA Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
P0CZ35 4.8e-21 93 34 5 191 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M3 (strain SSI-1)
Q48TP4 4.8e-21 93 34 5 191 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M28 (strain MGAS6180)
P0CZ34 4.8e-21 93 34 5 191 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
Q1DDP4 4.85e-21 92 31 4 209 3 metN Methionine import ATP-binding protein MetN Myxococcus xanthus (strain DK1622)
Q03PF2 4.86e-21 92 34 5 190 3 potA Spermidine/putrescine import ATP-binding protein PotA Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
B2KWH4 4.91e-21 94 31 4 194 2 ABC1 ABC transporter 1 Ajellomyces capsulatus
B2KWH4 1.08e-16 81 27 6 249 2 ABC1 ABC transporter 1 Ajellomyces capsulatus
Q6MMY0 4.99e-21 90 32 5 186 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)
Q2L0H5 5.17e-21 92 30 4 182 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Bordetella avium (strain 197N)
A0A0D1BUH6 5.43e-21 94 30 5 216 2 atr1 ABC-type transporter atr1 Ustilago maydis (strain 521 / FGSC 9021)
A0A0D1BUH6 4.27e-17 82 28 5 222 2 atr1 ABC-type transporter atr1 Ustilago maydis (strain 521 / FGSC 9021)
Q2G2M9 5.47e-21 94 36 8 200 3 SAOUHSC_02003 Putative multidrug export ATP-binding/permease protein SAOUHSC_02003 Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q6GFJ1 5.47e-21 94 36 8 200 3 SAR1956 Putative multidrug export ATP-binding/permease protein SAR1956 Staphylococcus aureus (strain MRSA252)
Q5HEQ8 5.47e-21 94 36 8 200 3 SACOL1924 Putative multidrug export ATP-binding/permease protein SACOL1924 Staphylococcus aureus (strain COL)
Q99T13 5.47e-21 94 36 8 200 1 SAV1866 Putative multidrug export ATP-binding/permease protein SAV1866 Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q2FFM9 5.47e-21 94 36 8 200 3 SAUSA300_1847 Putative multidrug export ATP-binding/permease protein SAUSA300_1847 Staphylococcus aureus (strain USA300)
Q7A0J1 5.47e-21 94 36 8 200 3 MW1806 Putative multidrug export ATP-binding/permease protein MW1806 Staphylococcus aureus (strain MW2)
Q6G868 5.47e-21 94 36 8 200 3 SAS1788 Putative multidrug export ATP-binding/permease protein SAS1788 Staphylococcus aureus (strain MSSA476)
Q7A4T3 5.47e-21 94 36 8 200 1 SA1683 Putative multidrug export ATP-binding/permease protein SA1683 Staphylococcus aureus (strain N315)
Q5YZY9 5.6e-21 92 34 4 181 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Nocardia farcinica (strain IFM 10152)
Q32EX7 5.7e-21 90 34 4 183 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Shigella dysenteriae serotype 1 (strain Sd197)
Q6MMH0 5.85e-21 90 30 6 212 3 pstB Phosphate import ATP-binding protein PstB Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)
Q04G50 5.95e-21 92 32 3 191 3 potA Spermidine/putrescine import ATP-binding protein PotA Oenococcus oeni (strain ATCC BAA-331 / PSU-1)
Q3Z300 6.07e-21 90 34 4 183 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Shigella sonnei (strain Ss046)
Q1RD37 6.07e-21 90 34 4 183 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Escherichia coli (strain UTI89 / UPEC)
Q8FIM7 6.07e-21 90 34 4 183 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TIV6 6.07e-21 90 34 4 183 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q4L5B3 6.14e-21 92 32 4 207 3 potA Spermidine/putrescine import ATP-binding protein PotA Staphylococcus haemolyticus (strain JCSC1435)
Q58206 6.18e-21 90 30 6 211 1 MJ0796 Uncharacterized ABC transporter ATP-binding protein MJ0796 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q8E8K8 6.32e-21 92 33 7 202 3 cysA2 Sulfate/thiosulfate import ATP-binding protein CysA 2 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q3SP57 6.38e-21 93 30 5 206 3 ndvA Beta-(1-->2)glucan export ATP-binding/permease protein NdvA Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
Q6F9P2 6.44e-21 92 35 5 197 3 metN2 Methionine import ATP-binding protein MetN 2 Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q53194 6.44e-21 92 28 5 193 3 NGR_a01400 Probable peptide ABC transporter ATP-binding protein y4tS Sinorhizobium fredii (strain NBRC 101917 / NGR234)
P06795 6.51e-21 94 30 6 192 1 Abcb1b ATP-dependent translocase ABCB1 Mus musculus
P06795 1.13e-20 93 29 6 196 1 Abcb1b ATP-dependent translocase ABCB1 Mus musculus
Q4KKK8 6.51e-21 92 35 6 182 3 metN1 Methionine import ATP-binding protein MetN 1 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q9JJ59 6.53e-21 93 30 4 196 1 Abcb9 ABC-type oligopeptide transporter ABCB9 Mus musculus
Q5M397 6.55e-21 92 33 5 206 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q0BMC9 6.56e-21 92 31 4 198 3 metN Methionine import ATP-binding protein MetN Francisella tularensis subsp. holarctica (strain OSU18)
Q2A3Z2 6.56e-21 92 31 4 198 3 metN Methionine import ATP-binding protein MetN Francisella tularensis subsp. holarctica (strain LVS)
Q5LYN4 6.68e-21 92 33 5 206 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus thermophilus (strain CNRZ 1066)
Q88KY4 6.72e-21 90 30 6 220 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q97UY8 6.78e-21 92 33 5 198 1 glcV Glucose import ATP-binding protein GlcV Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
Q5WUF8 7.16e-21 90 33 4 196 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Legionella pneumophila (strain Lens)
Q03JH1 7.31e-21 92 33 5 208 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
Q7A169 7.36e-21 92 36 4 169 3 potA Spermidine/putrescine import ATP-binding protein PotA Staphylococcus aureus (strain MW2)
Q6GAB5 7.36e-21 92 36 4 169 3 potA Spermidine/putrescine import ATP-binding protein PotA Staphylococcus aureus (strain MSSA476)
Q6GHY6 7.36e-21 92 36 4 169 3 potA Spermidine/putrescine import ATP-binding protein PotA Staphylococcus aureus (strain MRSA252)
Q7A679 7.36e-21 92 36 4 169 1 potA Spermidine/putrescine import ATP-binding protein PotA Staphylococcus aureus (strain N315)
Q99V03 7.36e-21 92 36 4 169 3 potA Spermidine/putrescine import ATP-binding protein PotA Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HGY5 7.36e-21 92 36 4 169 3 potA Spermidine/putrescine import ATP-binding protein PotA Staphylococcus aureus (strain COL)
Q2YX74 7.36e-21 92 36 4 169 3 potA Spermidine/putrescine import ATP-binding protein PotA Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q2G2A7 7.36e-21 92 36 4 169 3 potA Spermidine/putrescine import ATP-binding protein PotA Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FHY1 7.36e-21 92 36 4 169 3 potA Spermidine/putrescine import ATP-binding protein PotA Staphylococcus aureus (strain USA300)
Q325U1 7.51e-21 92 31 5 207 3 metN Methionine import ATP-binding protein MetN Shigella boydii serotype 4 (strain Sb227)
Q8DWR3 7.75e-21 90 30 3 190 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8E2L2 7.75e-21 90 30 3 190 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus agalactiae serotype III (strain NEM316)
Q3JYF4 7.75e-21 90 30 3 190 3 ecfA1 Energy-coupling factor transporter ATP-binding protein EcfA1 Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
P75957 7.81e-21 90 34 4 183 1 lolD Lipoprotein-releasing system ATP-binding protein LolD Escherichia coli (strain K12)
P61482 8.06e-21 90 34 4 183 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P61481 8.06e-21 90 34 4 183 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Salmonella typhi
Q5PGR6 8.06e-21 90 34 4 183 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q63VX7 8.1e-21 93 28 3 202 3 msbA ATP-dependent lipid A-core flippase Burkholderia pseudomallei (strain K96243)
Q3JUI6 8.1e-21 93 28 3 202 3 msbA ATP-dependent lipid A-core flippase Burkholderia pseudomallei (strain 1710b)
Q62IG3 8.1e-21 93 28 3 202 3 msbA ATP-dependent lipid A-core flippase Burkholderia mallei (strain ATCC 23344)
Q2YU20 8.11e-21 93 36 8 200 3 SAB1799c Putative multidrug export ATP-binding/permease protein SAB1799c Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q9TKX3 8.15e-21 92 31 5 204 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Nephroselmis olivacea
Q21BU8 8.22e-21 92 30 5 198 3 metN Methionine import ATP-binding protein MetN Rhodopseudomonas palustris (strain BisB18)
P43245 8.43e-21 93 30 6 192 2 Abcb1 ATP-dependent translocase ABCB1 Rattus norvegicus
P43245 8.95e-20 90 30 7 196 2 Abcb1 ATP-dependent translocase ABCB1 Rattus norvegicus
Q92XW1 8.52e-21 92 34 6 194 3 cysA1 Sulfate/thiosulfate import ATP-binding protein CysA 1 Rhizobium meliloti (strain 1021)
Q3IM24 8.6e-21 90 30 7 207 3 phnC2 Phosphonates import ATP-binding protein PhnC 2 Natronomonas pharaonis (strain ATCC 35678 / DSM 2160 / CIP 103997 / JCM 8858 / NBRC 14720 / NCIMB 2260 / Gabara)
P42423 8.63e-21 90 32 4 195 2 yxdL ABC transporter ATP-binding protein YxdL Bacillus subtilis (strain 168)
Q8DIA0 8.76e-21 91 34 5 197 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
H6TB12 8.86e-21 93 29 6 218 1 mdr Sophorolipid transporter Starmerella bombicola
H6TB12 7.77e-20 90 30 5 194 1 mdr Sophorolipid transporter Starmerella bombicola
Q81IZ6 8.95e-21 91 34 4 197 3 metN1 Methionine import ATP-binding protein MetN 1 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q9K8L5 9.38e-21 90 32 7 197 3 pstB Phosphate import ATP-binding protein PstB Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q9QY30 9.4e-21 93 32 6 192 1 Abcb11 Bile salt export pump Mus musculus
Q9QY30 1.45e-17 84 33 5 196 1 Abcb11 Bile salt export pump Mus musculus
Q8R9I2 1.01e-20 90 32 6 197 3 pstB2 Phosphate import ATP-binding protein PstB 2 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q609Q1 1.01e-20 91 32 4 193 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q57IS3 1.03e-20 91 30 5 199 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Salmonella choleraesuis (strain SC-B67)
A1TAI4 1.03e-20 92 32 4 193 3 potA Spermidine/putrescine import ATP-binding protein PotA Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
Q1QLB0 1.08e-20 89 32 4 183 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
P21440 1.11e-20 93 31 7 193 1 Abcb4 Phosphatidylcholine translocator ABCB4 Mus musculus
P21440 2.66e-20 92 30 6 196 1 Abcb4 Phosphatidylcholine translocator ABCB4 Mus musculus
Q97EK9 1.13e-20 90 32 5 197 3 ecfA2 Energy-coupling factor transporter ATP-binding protein EcfA2 Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q7MFC4 1.14e-20 91 34 6 198 3 malK Maltose/maltodextrin import ATP-binding protein MalK Vibrio vulnificus (strain YJ016)
Q8D3V0 1.14e-20 91 34 6 198 3 malK Maltose/maltodextrin import ATP-binding protein MalK Vibrio vulnificus (strain CMCP6)
Q9Z8Q8 1.17e-20 91 30 4 205 3 metN Methionine import ATP-binding protein MetN Chlamydia pneumoniae
Q57QD7 1.21e-20 89 33 4 183 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Salmonella choleraesuis (strain SC-B67)
Q4QMH4 1.22e-20 91 32 4 194 3 metN Methionine import ATP-binding protein MetN Haemophilus influenzae (strain 86-028NP)
P47532 1.27e-20 89 31 5 222 3 p29 Probable ABC transporter ATP-binding protein p29 Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
K3VYH8 1.28e-20 93 32 4 193 3 FPSE_09185 ABC transporter FPSE_09185 Fusarium pseudograminearum (strain CS3096)
K3VYH8 1.15e-11 67 22 7 271 3 FPSE_09185 ABC transporter FPSE_09185 Fusarium pseudograminearum (strain CS3096)
Q5WBL0 1.35e-20 89 34 5 189 3 ssuB3 Aliphatic sulfonates import ATP-binding protein SsuB 3 Shouchella clausii (strain KSM-K16)
Q7NIW1 1.35e-20 91 33 5 187 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
Q326G9 1.36e-20 89 37 5 177 3 thiQ Thiamine import ATP-binding protein ThiQ Shigella boydii serotype 4 (strain Sb227)
Q8G195 1.38e-20 89 30 5 215 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Brucella suis biovar 1 (strain 1330)
Q8YGM0 1.38e-20 89 30 5 215 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q57DS9 1.38e-20 89 30 5 215 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Brucella abortus biovar 1 (strain 9-941)
Q2YNH6 1.38e-20 89 30 5 215 3 lolD Lipoprotein-releasing system ATP-binding protein LolD Brucella abortus (strain 2308)
Q7VM95 1.4e-20 91 30 6 226 3 metN Methionine import ATP-binding protein MetN Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q254K9 1.43e-20 91 33 4 190 3 metN Methionine import ATP-binding protein MetN Chlamydia felis (strain Fe/C-56)
Q0T8D1 1.46e-20 89 37 5 177 3 thiQ Thiamine import ATP-binding protein ThiQ Shigella flexneri serotype 5b (strain 8401)
A1JRI2 1.47e-20 89 30 5 209 3 znuC Zinc import ATP-binding protein ZnuC Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q8DPC2 1.49e-20 91 32 4 199 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q97Q42 1.49e-20 91 32 4 199 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q04JW0 1.49e-20 91 32 4 199 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q83MG3 1.49e-20 89 37 5 177 3 thiQ Thiamine import ATP-binding protein ThiQ Shigella flexneri
Q8ZLF4 1.52e-20 91 30 5 199 1 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q6N999 1.52e-20 89 31 4 197 3 lolD1 Lipoprotein-releasing system ATP-binding protein LolD 1 Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
P31548 1.53e-20 89 36 4 174 1 thiQ Thiamine import ATP-binding protein ThiQ Escherichia coli (strain K12)
Q3AAA4 1.53e-20 89 32 7 198 3 pstB Phosphate import ATP-binding protein PstB Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
Q9JI39 1.55e-20 92 30 4 195 1 Abcb10 ATP-binding cassette sub-family B member 10, mitochondrial Mus musculus
Q1LQD3 1.55e-20 92 26 5 224 3 msbA ATP-dependent lipid A-core flippase Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q4WPP6 1.56e-20 92 31 5 195 2 mdr2 ABC multidrug transporter mdr2 Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS05675
Feature type CDS
Gene fetA
Product iron ABC transporter ATP-binding protein FetA
Location 1235369 - 1236019 (strand: -1)
Length 651 (nucleotides) / 216 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_299
Orthogroup size 8
N. genomes 7

Actions

Genomic region

Domains

PF00005 ABC transporter

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG4619 Inorganic ion transport and metabolism (P) P ABC-type iron transporter FetAB, ATPase component

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02068 UDP-glucose/iron transport system ATP-binding protein - -

Protein Sequence

MNNNRALLCLEKIGFQLDSKIILDNVTFSLQPSEFKLITGPSGCGKSTLLKIIASLLSPTSGTLFFDGKDYLTLSPEQYRQQVSYCTQTPMLFGETVYDNLKFPYLLRKIAVDEKKLAKDLDYFNLPNEILNKGINELSGGEKQRISLIRNLQFLPKVLLLDEITSALDEDNKIKVNELIHHYVKEQKIAALWVTHDQNEIKHADDVIHLPSHMNN

Flanking regions ( +/- flanking 50bp)

AACCTTGTATAATAGTGATAACTTCTCTCTTCTAGATGTATAGGATCAGAATGAACAATAATCGCGCACTACTATGTCTGGAAAAAATTGGCTTTCAACTCGATAGCAAAATTATTCTAGATAATGTGACTTTCTCACTACAACCTTCTGAATTTAAATTGATTACAGGCCCTTCTGGCTGTGGAAAAAGTACGTTATTAAAAATCATTGCCTCTTTATTATCACCGACAAGTGGCACACTTTTCTTTGACGGAAAAGACTACTTAACCCTTTCTCCTGAACAATACCGACAACAAGTTTCGTATTGTACTCAAACCCCGATGTTATTTGGTGAAACGGTTTATGACAATCTTAAATTTCCTTATTTACTACGCAAAATCGCCGTTGATGAGAAGAAATTAGCGAAAGATTTAGATTACTTTAATTTGCCCAATGAGATTTTAAATAAAGGTATTAATGAACTTTCTGGTGGTGAAAAACAGCGTATCTCACTTATCCGTAACCTACAGTTTTTGCCTAAAGTGTTATTGCTTGATGAAATTACTAGTGCTCTTGATGAAGACAATAAAATAAAAGTCAATGAGCTTATCCATCATTATGTCAAAGAGCAAAAAATCGCTGCATTATGGGTAACTCACGATCAAAATGAAATCAAACATGCCGATGATGTGATCCACTTACCGAGTCATATGAACAATTAAGGTTAGGTTGACTTCCATTACCCCCTTAGTTTTAACTTTATTGAGCAGTG