Homologs in group_125

Help

10 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_14510 FBDBKF_14510 37.5 Morganella morganii S1 - IS3 family transposase
FBDBKF_17935 FBDBKF_17935 33.3 Morganella morganii S1 - Integrase core domain
EHELCC_06400 EHELCC_06400 33.3 Morganella morganii S2 - Integrase core domain
EHELCC_07770 EHELCC_07770 37.5 Morganella morganii S2 - IS3 family transposase
NLDBIP_06720 NLDBIP_06720 33.3 Morganella morganii S4 - Integrase core domain
NLDBIP_08095 NLDBIP_08095 37.5 Morganella morganii S4 - IS3 family transposase
LHKJJB_06170 LHKJJB_06170 37.5 Morganella morganii S3 - IS3 family transposase
LHKJJB_19320 LHKJJB_19320 33.3 Morganella morganii S3 - Integrase core domain
HKOGLL_04670 HKOGLL_04670 33.3 Morganella morganii S5 - Integrase core domain
HKOGLL_04745 HKOGLL_04745 37.5 Morganella morganii S5 - IS3 family transposase

Distribution of the homologs in the orthogroup group_125

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_125

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q9JMT3 6.9e-13 64 39 1 82 3 insF7 Transposase InsF for insertion sequence IS3fB Escherichia coli (strain K12)
P0CF85 8.72e-13 64 39 1 82 3 insF Transposase InsF for insertion sequence IS3 Escherichia coli O111:H-
P0CF84 8.72e-13 64 39 1 82 3 insF6 Transposase InsF for insertion sequence IS3fA Escherichia coli (strain K12)
P0CF83 8.72e-13 64 39 1 82 3 insF5 Transposase InsF for insertion sequence IS3E Escherichia coli (strain K12)
P0CF82 8.72e-13 64 39 1 82 3 insF4 Transposase InsF for insertion sequence IS3D Escherichia coli (strain K12)
P0CF81 8.72e-13 64 39 1 82 3 insF3 Transposase InsF for insertion sequence IS3C Escherichia coli (strain K12)
P0CF80 8.72e-13 64 39 1 82 3 insF2 Transposase InsF for insertion sequence IS3B Escherichia coli (strain K12)
P0CF79 8.72e-13 64 39 1 82 3 insF1 Transposase InsF for insertion sequence IS3A Escherichia coli (strain K12)
P16940 4.06e-12 62 41 0 73 4 None Insertion element IS600 uncharacterized 31 kDa protein Shigella sonnei
Q47718 1.3e-11 60 35 1 82 5 insO2 Putative transposase InsO for insertion sequence element IS911B Escherichia coli (strain K12)
P9WKH9 1.54e-09 55 37 0 77 4 Rv0796 Putative transposase for insertion sequence element IS986/IS6110 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
A5TY79 1.54e-09 55 37 0 77 3 MRA_0011 Putative transposase for insertion sequence element IS986/IS6110 Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
P59800 1.54e-09 55 37 0 77 3 BQ2027_MB2838C Putative transposase for insertion sequence element IS986/IS6110 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WKH8 1.57e-09 55 37 0 77 3 MT1803 Putative transposase for insertion sequence element IS986/IS6110 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P35878 9.37e-09 53 42 2 78 3 nisX1 Transposase for insertion sequence element IS904 Lactococcus lactis subsp. lactis (strain IL1403)
O05086 0.000124 41 32 1 75 3 HI_1721 Uncharacterized transposase-like protein HI_1721 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS18830
Feature type CDS
Gene -
Product IS3 family transposase
Location 375328 - 375576 (strand: 1)
Length 249 (nucleotides) / 82 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_125
Orthogroup size 11
N. genomes 6

Actions

Genomic region

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2801 Mobilome: prophages, transposons (X) X Transposase InsO and inactivated derivatives

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K07497 putative transposase - -

Protein Sequence

MSAYGVQKLMAQLGLVVTQRVAYKVTTKRKHSDAVVDNLLNQNVNPHAPNEVRAGDVTYLKTGEGWVYLVIVMDLYSRRIAG

Flanking regions ( +/- flanking 50bp)

GCTTAGGTTACATAACGTGACATAAACGGTTATGCAAAGAGGGCTTTAGCGTGAGTGCTTATGGCGTTCAAAAGCTAATGGCTCAGCTTGGCCTAGTCGTCACTCAGCGTGTTGCTTACAAAGTCACCACAAAACGCAAACACAGTGATGCGGTAGTCGATAATTTGTTAAATCAAAATGTTAATCCTCACGCACCTAACGAAGTGCGGGCGGGTGATGTGACCTATTTAAAAACAGGGGAGGGCTGGGTGTATTTAGTCATCGTGATGGACTTATACTCACGCCGTATTGCGGGTTGACACATCGATAAACGAATGACGGCAGATTTAGTTGTGCAGAACAATTAGGG