Homologs in group_125

Help

10 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_14510 FBDBKF_14510 85.8 Morganella morganii S1 - IS3 family transposase
FBDBKF_17935 FBDBKF_17935 100.0 Morganella morganii S1 - Integrase core domain
EHELCC_06400 EHELCC_06400 100.0 Morganella morganii S2 - Integrase core domain
EHELCC_07770 EHELCC_07770 85.8 Morganella morganii S2 - IS3 family transposase
NLDBIP_06720 NLDBIP_06720 100.0 Morganella morganii S4 - Integrase core domain
NLDBIP_08095 NLDBIP_08095 85.8 Morganella morganii S4 - IS3 family transposase
LHKJJB_06170 LHKJJB_06170 85.8 Morganella morganii S3 - IS3 family transposase
HKOGLL_04670 HKOGLL_04670 100.0 Morganella morganii S5 - Integrase core domain
HKOGLL_04745 HKOGLL_04745 85.8 Morganella morganii S5 - IS3 family transposase
PMI_RS18830 PMI_RS18830 33.3 Proteus mirabilis HI4320 - IS3 family transposase

Distribution of the homologs in the orthogroup group_125

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_125

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q47718 1.35e-67 204 83 0 114 5 insO2 Putative transposase InsO for insertion sequence element IS911B Escherichia coli (strain K12)
P75680 6.97e-31 109 79 0 62 5 insO1 Putative transposase InsO for insertion sequence element IS911A Escherichia coli (strain K12)
P0CF85 5.04e-14 69 43 0 79 3 insF Transposase InsF for insertion sequence IS3 Escherichia coli O111:H-
P0CF84 5.04e-14 69 43 0 79 3 insF6 Transposase InsF for insertion sequence IS3fA Escherichia coli (strain K12)
P0CF83 5.04e-14 69 43 0 79 3 insF5 Transposase InsF for insertion sequence IS3E Escherichia coli (strain K12)
P0CF82 5.04e-14 69 43 0 79 3 insF4 Transposase InsF for insertion sequence IS3D Escherichia coli (strain K12)
P0CF81 5.04e-14 69 43 0 79 3 insF3 Transposase InsF for insertion sequence IS3C Escherichia coli (strain K12)
P0CF80 5.04e-14 69 43 0 79 3 insF2 Transposase InsF for insertion sequence IS3B Escherichia coli (strain K12)
P0CF79 5.04e-14 69 43 0 79 3 insF1 Transposase InsF for insertion sequence IS3A Escherichia coli (strain K12)
Q9JMT3 1.19e-13 68 43 0 79 3 insF7 Transposase InsF for insertion sequence IS3fB Escherichia coli (strain K12)
P35878 1.47e-13 67 35 2 111 3 nisX1 Transposase for insertion sequence element IS904 Lactococcus lactis subsp. lactis (strain IL1403)
P16942 3.05e-12 64 40 2 84 4 None Transposase for insertion sequence element IS629 Shigella sonnei
P16940 7.21e-12 63 35 2 109 4 None Insertion element IS600 uncharacterized 31 kDa protein Shigella sonnei
P11257 7.02e-09 54 38 1 73 4 None Transposase for insertion sequence element IS3411 Escherichia coli
P19769 1.22e-08 54 31 3 111 2 insK Putative transposase InsK for insertion sequence element IS150 Escherichia coli (strain K12)
O05086 6.52e-08 52 31 4 110 3 HI_1721 Uncharacterized transposase-like protein HI_1721 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P9WKH8 6.37e-06 46 29 3 113 3 MT1803 Putative transposase for insertion sequence element IS986/IS6110 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q79CE8 8.22e-06 46 29 0 88 3 None Probable transposase for insertion sequence element IS1353 Shigella flexneri
P9WKH9 1.11e-05 45 29 3 113 4 Rv0796 Putative transposase for insertion sequence element IS986/IS6110 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
A5TY79 1.11e-05 45 29 3 113 3 MRA_0011 Putative transposase for insertion sequence element IS986/IS6110 Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
P59800 1.11e-05 45 29 3 113 3 BQ2027_MB2838C Putative transposase for insertion sequence element IS986/IS6110 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)

  • Number of RefSeq hits:

General

Source Morganella morganii S3
Locus tag LHKJJB_19320
Feature type CDS
Gene -
Product Integrase core domain
Location 10973 - 11320 (strand: -1)
Length 348 (nucleotides) / 115 (amino acids)
In genomic island -

Contig

Accession ZDB_390
Length 13558 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_125
Orthogroup size 11
N. genomes 6

Actions

Genomic region

Domains

PF00665 Integrase core domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2801 Mobilome: prophages, transposons (X) X Transposase InsO and inactivated derivatives

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K07497 putative transposase - -

Protein Sequence

MERWLAGHLMRKLGLVSCQQPVHRYRRGGHEHIAIPNHLGRQFAVTVPDQVWCGDVTYIWTGKRRTYLAVVLDLFARKPVGWAMSFSPDSRLTTKALKMAWERRGKPSGVMFHSD

Flanking regions ( +/- flanking 50bp)

CCGAGGATGCAAGAAGTATCGCCACAATGGCCACACACAGGGGCTTCCGGATGGAACGATGGCTTGCCGGCCATCTTATGAGGAAGCTGGGGCTGGTGAGTTGTCAGCAGCCTGTTCACCGATATAGACGTGGGGGACACGAACATATTGCTATCCCGAATCACCTCGGACGTCAGTTTGCAGTGACAGTGCCTGACCAGGTATGGTGCGGCGATGTGACGTATATCTGGACAGGTAAACGCCGGACTTACCTTGCTGTGGTACTCGATCTATTTGCACGGAAACCCGTGGGGTGGGCAATGTCGTTCTCTCCGGACAGCAGGCTGACCACCAAAGCACTGAAAATGGCATGGGAAAGACGCGGTAAGCCATCCGGGGTTATGTTCCACAGTGATTAGGGTAGTCACTATACAAGCAGGTAGTTCAGGCAGTTACTGTGGCGATACCG