Homologs in group_127

Help

10 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_17935 FBDBKF_17935 85.8 Morganella morganii S1 - Integrase core domain
EHELCC_06400 EHELCC_06400 85.8 Morganella morganii S2 - Integrase core domain
EHELCC_07770 EHELCC_07770 100.0 Morganella morganii S2 - IS3 family transposase
NLDBIP_06720 NLDBIP_06720 85.8 Morganella morganii S4 - Integrase core domain
NLDBIP_08095 NLDBIP_08095 100.0 Morganella morganii S4 - IS3 family transposase
LHKJJB_06170 LHKJJB_06170 100.0 Morganella morganii S3 - IS3 family transposase
LHKJJB_19320 LHKJJB_19320 85.8 Morganella morganii S3 - Integrase core domain
HKOGLL_04670 HKOGLL_04670 85.8 Morganella morganii S5 - Integrase core domain
HKOGLL_04745 HKOGLL_04745 100.0 Morganella morganii S5 - IS3 family transposase
PMI_RS18830 PMI_RS18830 37.5 Proteus mirabilis HI4320 - IS3 family transposase

Distribution of the homologs in the orthogroup group_127

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_127

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q47718 1.89e-67 208 87 0 105 5 insO2 Putative transposase InsO for insertion sequence element IS911B Escherichia coli (strain K12)
P16940 1.04e-38 137 38 1 197 4 None Insertion element IS600 uncharacterized 31 kDa protein Shigella sonnei
Q9JMT3 5.66e-36 130 38 0 169 3 insF7 Transposase InsF for insertion sequence IS3fB Escherichia coli (strain K12)
P0CF85 8.49e-36 130 37 0 169 3 insF Transposase InsF for insertion sequence IS3 Escherichia coli O111:H-
P0CF84 8.49e-36 130 37 0 169 3 insF6 Transposase InsF for insertion sequence IS3fA Escherichia coli (strain K12)
P0CF83 8.49e-36 130 37 0 169 3 insF5 Transposase InsF for insertion sequence IS3E Escherichia coli (strain K12)
P0CF82 8.49e-36 130 37 0 169 3 insF4 Transposase InsF for insertion sequence IS3D Escherichia coli (strain K12)
P0CF81 8.49e-36 130 37 0 169 3 insF3 Transposase InsF for insertion sequence IS3C Escherichia coli (strain K12)
P0CF80 8.49e-36 130 37 0 169 3 insF2 Transposase InsF for insertion sequence IS3B Escherichia coli (strain K12)
P0CF79 8.49e-36 130 37 0 169 3 insF1 Transposase InsF for insertion sequence IS3A Escherichia coli (strain K12)
P35878 4.46e-34 124 39 1 167 3 nisX1 Transposase for insertion sequence element IS904 Lactococcus lactis subsp. lactis (strain IL1403)
P19769 5.2e-31 117 37 4 197 2 insK Putative transposase InsK for insertion sequence element IS150 Escherichia coli (strain K12)
P75680 1.09e-28 107 93 0 49 5 insO1 Putative transposase InsO for insertion sequence element IS911A Escherichia coli (strain K12)
O05086 3.75e-23 95 33 4 191 3 HI_1721 Uncharacterized transposase-like protein HI_1721 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P16942 3.46e-22 94 31 2 197 4 None Transposase for insertion sequence element IS629 Shigella sonnei
P9WKH8 2.52e-18 84 29 2 203 3 MT1803 Putative transposase for insertion sequence element IS986/IS6110 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P9WKH9 8.97e-18 82 28 2 203 4 Rv0796 Putative transposase for insertion sequence element IS986/IS6110 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
A5TY79 8.97e-18 82 28 2 203 3 MRA_0011 Putative transposase for insertion sequence element IS986/IS6110 Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
P59800 8.97e-18 82 28 2 203 3 BQ2027_MB2838C Putative transposase for insertion sequence element IS986/IS6110 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q9JMS8 1.39e-16 74 52 0 67 4 yuaL Uncharacterized protein YuaL Escherichia coli (strain K12)
Q79CE8 3.34e-14 73 29 1 175 3 None Probable transposase for insertion sequence element IS1353 Shigella flexneri
Q06715 7.42e-12 66 28 1 153 4 None ATP-dependent protease Lactococcus lactis subsp. lactis
P11257 2.97e-09 58 31 0 99 4 None Transposase for insertion sequence element IS3411 Escherichia coli
P25438 6.38e-08 55 25 5 179 4 None Insertion element IS476 uncharacterized 39.2 kDa protein Xanthomonas euvesicatoria
P0A3L4 1.06e-06 50 23 4 155 4 None Insertion element IS136 uncharacterized protein Agrobacterium tumefaciens (strain T37)
P0A3L3 1.06e-06 50 23 4 155 4 Atu4601 Insertion element IS136 uncharacterized protein Atu4601 Agrobacterium fabrum (strain C58 / ATCC 33970)
P18416 1.77e-06 51 25 6 152 4 None Transposase for transposon Tn552 Staphylococcus aureus
O05023 5.42e-06 47 34 0 72 3 HI_0493 Uncharacterized transposase-like protein HI_0493 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_14510
Feature type CDS
Gene -
Product IS3 family transposase
Location 98328 - 98954 (strand: 1)
Length 627 (nucleotides) / 208 (amino acids)

Contig

Accession contig_18
Length 100673 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_127
Orthogroup size 11
N. genomes 6

Actions

Genomic region

Domains

PF00665 Integrase core domain
PF13333 Integrase core domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2801 Mobilome: prophages, transposons (X) X Transposase InsO and inactivated derivatives

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K07497 putative transposase - -

Protein Sequence

MKEMGLVSCQQPVHRYKRGGHEHIAIPNHLERQFAVTEPNQVWCGDVTYIWTGKRWAYLAIVLDLFARKPVGWAMSFSPDSKLTTKALEMAWEIRNKPSGLMFHSDQGSHYTSRQFRQLLWRYRIKQSMSRRGNCWDNSPMERFFRSLKNEWVPVTSYTNFNEAVHAIMDYIVGYYSEVRPHEYNGGLPPNESENQYRKNSKTMASFS

Flanking regions ( +/- flanking 50bp)

TGGCAACACGCAGGGGCTTCCGGATGGGACGATGGCTTGCCGGACGGCTAATGAAGGAGATGGGGCTGGTGAGCTGTCAGCAGCCTGTTCACCGGTATAAACGTGGCGGTCATGAACACATTGCTATCCCGAACCACCTTGAGCGACAGTTCGCAGTGACAGAGCCCAATCAGGTATGGTGCGGCGACGTAACGTATATCTGGACCGGTAAACGCTGGGCATACCTGGCCATTGTACTCGACCTGTTCGCAAGAAAACCCGTGGGCTGGGCAATGTCATTTTCTCCGGACAGCAAACTGACCACCAAAGCGCTGGAAATGGCATGGGAAATACGAAATAAGCCATCCGGGCTCATGTTCCACAGTGATCAGGGCAGCCATTATACAAGCAGGCAGTTCCGACAGTTACTGTGGCGATACCGGATAAAACAAAGTATGAGCAGGCGGGGTAACTGCTGGGATAACAGCCCGATGGAGCGCTTCTTCAGAAGTCTGAAAAATGAGTGGGTGCCGGTGACCAGCTACACCAACTTCAATGAAGCAGTCCATGCAATAATGGATTATATCGTCGGGTATTACAGCGAAGTCAGACCGCATGAATATAACGGTGGATTACCACCAAACGAATCAGAAAACCAATACCGAAAAAACTCTAAAACCATGGCCAGTTTTAGTTGACCACTACAAACCTCGTCAGTGACAGCGCTGATGGTAGCTGCGGAGACGCT