Homologs in group_236

Help

7 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_03270 FBDBKF_03270 68.9 Morganella morganii S1 npr PTS phosphocarrier protein NPr
EHELCC_07265 EHELCC_07265 68.9 Morganella morganii S2 npr PTS phosphocarrier protein NPr
NLDBIP_07590 NLDBIP_07590 68.9 Morganella morganii S4 npr PTS phosphocarrier protein NPr
LHKJJB_07125 LHKJJB_07125 68.9 Morganella morganii S3 npr PTS phosphocarrier protein NPr
HKOGLL_03805 HKOGLL_03805 68.9 Morganella morganii S5 npr PTS phosphocarrier protein NPr
F4V73_RS11650 F4V73_RS11650 67.8 Morganella psychrotolerans npr PTS phosphocarrier protein NPr
PMI_RS11895 PMI_RS11895 43.4 Proteus mirabilis HI4320 dhaM dihydroxyacetone kinase phosphoryl donor subunit DhaM

Distribution of the homologs in the orthogroup group_236

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_236

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q9ZA86 2.31e-62 186 100 0 90 3 ptsO Phosphocarrier protein NPr Proteus mirabilis (strain HI4320)
P0A9N3 6.97e-35 117 62 0 90 3 ptsO Phosphocarrier protein NPr Shigella flexneri
P0A9N0 6.97e-35 117 62 0 90 1 ptsO Phosphocarrier protein NPr Escherichia coli (strain K12)
P0A9N1 6.97e-35 117 62 0 90 3 ptsO Phosphocarrier protein NPr Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0A9N2 6.97e-35 117 62 0 90 3 ptsO Phosphocarrier protein NPr Escherichia coli O157:H7
P51185 8.21e-33 112 60 0 90 3 ptsO Phosphocarrier protein NPr Klebsiella oxytoca
Q9KP46 1.22e-21 84 45 0 86 3 npr Phosphocarrier protein NPr Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P75061 5.88e-14 64 40 0 79 1 ptsH Phosphocarrier protein HPr Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
Q9S0K8 6.54e-14 64 42 2 90 3 ptsO Phosphocarrier protein NPr Shewanella violacea (strain JCM 10179 / CIP 106290 / LMG 19151 / DSS12)
Q87DQ0 8.73e-14 63 38 1 84 3 ptsH Phosphocarrier protein HPr Xylella fastidiosa (strain Temecula1 / ATCC 700964)
Q9PDH6 1.38e-13 63 39 1 82 3 ptsH Phosphocarrier protein HPr Xylella fastidiosa (strain 9a5c)
P23537 5.38e-13 61 38 1 85 3 phbH Phosphocarrier protein HPr Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
P47287 4.43e-10 54 38 1 84 3 ptsH Phosphocarrier protein HPr Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
Q9Z426 9.64e-09 50 29 0 85 3 ptsH Phosphocarrier protein HPr Pseudomonas putida
Q9HVV2 2.03e-08 50 32 2 84 3 ptsH Phosphocarrier protein HPr Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P65877 2.44e-08 50 30 1 85 3 ptsH Phosphocarrier protein HPr Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
P65876 2.44e-08 50 30 1 85 3 ptsH Phosphocarrier protein HPr Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q9K8D2 2.52e-08 49 29 1 85 3 ptsH Phosphocarrier protein HPr Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
O83598 1.05e-07 48 30 1 86 3 ptsH Phosphocarrier protein HPr Treponema pallidum (strain Nichols)
P0DN88 1.58e-07 50 35 2 89 3 dhaM PEP-dependent dihydroxyacetone kinase, phosphoryl donor subunit DhaM Providencia stuartii (strain MRSN 2154)
Q9K708 2.96e-07 47 32 1 80 3 crh HPr-like protein Crh Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
O07125 4.37e-07 46 37 1 66 3 ptsH Phosphocarrier protein HPr Latilactobacillus sakei
P44715 8.27e-07 48 34 2 85 3 fruB Multiphosphoryl transfer protein Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P44715 1.79e-06 47 32 1 84 3 fruB Multiphosphoryl transfer protein Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q84F84 4.03e-06 44 30 1 79 1 ptsH Phosphocarrier protein HPr Lysinibacillus sphaericus
P69811 5.09e-06 46 28 1 83 1 fruB Multiphosphoryl transfer protein Escherichia coli (strain K12)
P69812 5.09e-06 46 28 1 83 3 fruB Multiphosphoryl transfer protein Escherichia coli O157:H7
P07515 6.83e-06 43 34 1 67 1 ptsH Phosphocarrier protein HPr Enterococcus faecalis (strain ATCC 700802 / V583)
P24366 7.94e-06 43 36 2 72 1 ptsH Phosphocarrier protein HPr Streptococcus salivarius
P0AA09 9.15e-06 43 30 1 78 3 ptsH Phosphocarrier protein HPr Shigella flexneri
P0AA07 9.15e-06 43 30 1 78 1 ptsH Phosphocarrier protein HPr Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0AA08 9.15e-06 43 30 1 78 3 ptsH Phosphocarrier protein HPr Salmonella typhi
P0AA04 9.15e-06 43 30 1 78 1 ptsH Phosphocarrier protein HPr Escherichia coli (strain K12)
P0AA05 9.15e-06 43 30 1 78 3 ptsH Phosphocarrier protein HPr Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AA06 9.15e-06 43 30 1 78 3 ptsH Phosphocarrier protein HPr Escherichia coli O157:H7
P08877 9.32e-06 43 33 1 66 1 ptsH Phosphocarrier protein HPr Bacillus subtilis (strain 168)
P43921 1.24e-05 42 31 1 72 3 ptsH Phosphocarrier protein HPr Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P17127 1.48e-05 44 28 1 83 1 fruB Multiphosphoryl transfer protein Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8Z591 1.55e-05 44 28 1 83 3 fruB Multiphosphoryl transfer protein Salmonella typhi
O06976 1.88e-05 42 29 1 77 1 crh HPr-like protein Crh Bacillus subtilis (strain 168)
Q9CJ83 2.16e-05 42 34 1 66 1 ptsH Phosphocarrier protein HPr Lactococcus lactis subsp. lactis (strain IL1403)
P16481 2.36e-05 42 29 1 78 3 ptsH Phosphocarrier protein HPr Klebsiella pneumoniae
Q9ZAD9 2.4e-05 42 34 1 66 3 ptsH Phosphocarrier protein HPr Lactococcus lactis subsp. cremoris
Q9EYQ9 3.31e-05 42 32 1 75 1 ptsH Phosphocarrier protein HPr Staphylococcus xylosus
P45611 3.89e-05 41 32 1 71 1 ptsH Phosphocarrier protein HPr Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154)
P0A438 4.06e-05 41 30 2 84 3 ptsH Phosphocarrier protein HPr Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
P0A439 4.06e-05 41 30 2 84 3 ptsH Phosphocarrier protein HPr Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q9KTD6 5.69e-05 41 28 1 80 1 ptsH Phosphocarrier protein HPr Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P23388 6.29e-05 43 38 1 84 3 fruB(HI) Multiphosphoryl transfer protein Rhodobacter capsulatus
P0A0E2 8.79e-05 40 33 1 71 3 ptsH Phosphocarrier protein HPr Staphylococcus aureus (strain MW2)
P0A0E3 8.79e-05 40 33 1 71 1 ptsH Phosphocarrier protein HPr Staphylococcus aureus
Q6GAD1 8.79e-05 40 33 1 71 3 ptsH Phosphocarrier protein HPr Staphylococcus aureus (strain MSSA476)
Q6GI02 8.79e-05 40 33 1 71 3 ptsH Phosphocarrier protein HPr Staphylococcus aureus (strain MRSA252)
P99143 8.79e-05 40 33 1 71 1 ptsH Phosphocarrier protein HPr Staphylococcus aureus (strain N315)
P0A0E1 8.79e-05 40 33 1 71 3 ptsH Phosphocarrier protein HPr Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HH02 8.79e-05 40 33 1 71 3 ptsH Phosphocarrier protein HPr Staphylococcus aureus (strain COL)
O69250 0.000114 40 33 1 66 1 ptsH Phosphocarrier protein HPr Priestia megaterium
P23534 0.000128 40 32 1 75 1 ptsH Phosphocarrier protein HPr Staphylococcus carnosus
Q9F166 0.000128 40 33 1 66 1 ptsH Phosphocarrier protein HPr Bacillus thuringiensis subsp. israelensis
Q9PK56 0.000262 39 32 3 84 3 ptsH Phosphocarrier protein HPr Chlamydia muridarum (strain MoPn / Nigg)
O84341 0.000355 39 28 1 81 3 ptsH Phosphocarrier protein HPr Chlamydia trachomatis serovar D (strain ATCC VR-885 / DSM 19411 / UW-3/Cx)
P32670 0.000419 40 36 1 63 3 ptsA Multiphosphoryl transfer protein 2 Escherichia coli (strain K12)
Q9WXI5 0.000475 38 33 1 72 3 ptsH Phosphocarrier protein HPr Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
P37349 0.000644 40 33 2 84 1 dhaM PEP-dependent dihydroxyacetone kinase, phosphoryl donor subunit DhaM Escherichia coli (strain K12)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS18130
Feature type CDS
Gene npr
Product PTS phosphocarrier protein NPr
Location 3983144 - 3983416 (strand: -1)
Length 273 (nucleotides) / 90 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_236
Orthogroup size 8
N. genomes 7

Actions

Genomic region

Domains

PF00381 PTS HPr component phosphorylation site

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1925 Signal transduction mechanisms (T)
Carbohydrate transport and metabolism (G)
TG HPr or related phosphotransfer protein

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K08485 phosphocarrier protein NPr Phosphotransferase system (PTS) -

Protein Sequence

MTQYRRVAIKNRLGMHARPAMKLFDLVNTFQSTVTLRNHEGVEAQADSVIAMLMLDSEQGSHIDIEASGCDEKEAIDAIIALFESGFDED

Flanking regions ( +/- flanking 50bp)

TCTAGAGGGAAAAACGTACAATCACGCCATAGAACACTTGAAAAGCGCAAATGACCCAATATCGACGCGTAGCGATAAAAAACCGTTTAGGCATGCATGCAAGGCCTGCCATGAAATTGTTTGATTTGGTCAATACATTTCAATCAACGGTGACGTTACGTAACCATGAAGGCGTTGAGGCGCAAGCAGATAGTGTGATTGCGATGTTGATGTTAGATTCCGAACAAGGCAGTCACATCGATATAGAAGCCAGTGGCTGTGATGAAAAAGAAGCGATTGATGCGATTATTGCATTATTTGAATCAGGGTTTGATGAAGATTAATTCTAATTAAAAACAATAGATTAGCATTTCTTAACAAAAATCCCAGAAAG