Homologs in group_236

Help

7 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_03270 FBDBKF_03270 95.6 Morganella morganii S1 npr PTS phosphocarrier protein NPr
EHELCC_07265 EHELCC_07265 95.6 Morganella morganii S2 npr PTS phosphocarrier protein NPr
NLDBIP_07590 NLDBIP_07590 95.6 Morganella morganii S4 npr PTS phosphocarrier protein NPr
LHKJJB_07125 LHKJJB_07125 95.6 Morganella morganii S3 npr PTS phosphocarrier protein NPr
HKOGLL_03805 HKOGLL_03805 95.6 Morganella morganii S5 npr PTS phosphocarrier protein NPr
PMI_RS11895 PMI_RS11895 41.0 Proteus mirabilis HI4320 dhaM dihydroxyacetone kinase phosphoryl donor subunit DhaM
PMI_RS18130 PMI_RS18130 67.8 Proteus mirabilis HI4320 npr PTS phosphocarrier protein NPr

Distribution of the homologs in the orthogroup group_236

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_236

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q9ZA86 1.04e-37 124 67 0 90 3 ptsO Phosphocarrier protein NPr Proteus mirabilis (strain HI4320)
P0A9N3 1.66e-34 116 61 0 90 3 ptsO Phosphocarrier protein NPr Shigella flexneri
P0A9N0 1.66e-34 116 61 0 90 1 ptsO Phosphocarrier protein NPr Escherichia coli (strain K12)
P0A9N1 1.66e-34 116 61 0 90 3 ptsO Phosphocarrier protein NPr Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0A9N2 1.66e-34 116 61 0 90 3 ptsO Phosphocarrier protein NPr Escherichia coli O157:H7
P51185 2.43e-31 108 55 0 90 3 ptsO Phosphocarrier protein NPr Klebsiella oxytoca
Q9KP46 1.19e-19 79 45 0 84 3 npr Phosphocarrier protein NPr Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q87DQ0 6.31e-15 66 36 1 85 3 ptsH Phosphocarrier protein HPr Xylella fastidiosa (strain Temecula1 / ATCC 700964)
Q9PDH6 9.66e-15 66 37 1 82 3 ptsH Phosphocarrier protein HPr Xylella fastidiosa (strain 9a5c)
Q9S0K8 3.17e-13 62 41 1 84 3 ptsO Phosphocarrier protein NPr Shewanella violacea (strain JCM 10179 / CIP 106290 / LMG 19151 / DSS12)
P65877 3.85e-12 59 33 1 87 3 ptsH Phosphocarrier protein HPr Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
P65876 3.85e-12 59 33 1 87 3 ptsH Phosphocarrier protein HPr Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
P23537 5.9e-11 56 39 2 82 3 phbH Phosphocarrier protein HPr Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
O83598 2.47e-08 49 33 1 84 3 ptsH Phosphocarrier protein HPr Treponema pallidum (strain Nichols)
Q9HVV2 3.27e-08 49 33 2 86 3 ptsH Phosphocarrier protein HPr Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9Z426 3.49e-08 49 29 0 84 3 ptsH Phosphocarrier protein HPr Pseudomonas putida
Q9K708 3.03e-07 47 35 1 82 3 crh HPr-like protein Crh Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q9KTD6 8.73e-07 45 30 1 79 1 ptsH Phosphocarrier protein HPr Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P43921 2.18e-06 44 34 1 76 3 ptsH Phosphocarrier protein HPr Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P44715 3.06e-06 46 32 1 84 3 fruB Multiphosphoryl transfer protein Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P44715 5.29e-06 46 31 1 83 3 fruB Multiphosphoryl transfer protein Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q84F84 3.99e-06 44 34 1 78 1 ptsH Phosphocarrier protein HPr Lysinibacillus sphaericus
O84341 4.95e-06 44 30 2 83 3 ptsH Phosphocarrier protein HPr Chlamydia trachomatis serovar D (strain ATCC VR-885 / DSM 19411 / UW-3/Cx)
P0AA09 8.49e-06 43 31 1 77 3 ptsH Phosphocarrier protein HPr Shigella flexneri
P0AA07 8.49e-06 43 31 1 77 1 ptsH Phosphocarrier protein HPr Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0AA08 8.49e-06 43 31 1 77 3 ptsH Phosphocarrier protein HPr Salmonella typhi
P0AA04 8.49e-06 43 31 1 77 1 ptsH Phosphocarrier protein HPr Escherichia coli (strain K12)
P0AA05 8.49e-06 43 31 1 77 3 ptsH Phosphocarrier protein HPr Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AA06 8.49e-06 43 31 1 77 3 ptsH Phosphocarrier protein HPr Escherichia coli O157:H7
Q9PK56 1.05e-05 43 31 2 83 3 ptsH Phosphocarrier protein HPr Chlamydia muridarum (strain MoPn / Nigg)
P0DN88 1.36e-05 45 34 1 88 3 dhaM PEP-dependent dihydroxyacetone kinase, phosphoryl donor subunit DhaM Providencia stuartii (strain MRSN 2154)
P16481 1.69e-05 42 31 1 77 3 ptsH Phosphocarrier protein HPr Klebsiella pneumoniae
Q9WXI5 1.92e-05 42 36 2 76 3 ptsH Phosphocarrier protein HPr Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
P75061 3.93e-05 41 28 0 81 1 ptsH Phosphocarrier protein HPr Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
D4GL26 5.28e-05 43 31 1 83 3 dhaM PEP-dependent dihydroxyacetone kinase, phosphoryl donor subunit DhaM Pantoea ananatis (strain LMG 20103)
P69811 9.64e-05 42 30 1 83 1 fruB Multiphosphoryl transfer protein Escherichia coli (strain K12)
P69812 9.64e-05 42 30 1 83 3 fruB Multiphosphoryl transfer protein Escherichia coli O157:H7
O07125 0.000115 40 36 1 66 3 ptsH Phosphocarrier protein HPr Latilactobacillus sakei
Q8Z591 0.000116 42 30 1 83 3 fruB Multiphosphoryl transfer protein Salmonella typhi
P17127 0.000121 42 30 1 83 1 fruB Multiphosphoryl transfer protein Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
O06976 0.000123 40 31 1 77 1 crh HPr-like protein Crh Bacillus subtilis (strain 168)
Q9Z9E4 0.000177 40 32 1 81 3 ptsH Phosphocarrier protein HPr Chlamydia pneumoniae
P45611 0.000182 40 36 2 73 1 ptsH Phosphocarrier protein HPr Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154)
P23388 0.000254 41 34 1 63 3 fruB(HI) Multiphosphoryl transfer protein Rhodobacter capsulatus
Q9K8D2 0.000286 39 27 1 81 3 ptsH Phosphocarrier protein HPr Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q9KM70 0.000558 40 30 1 83 2 fruB Multiphosphoryl transfer protein Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P37349 0.000831 39 31 1 83 1 dhaM PEP-dependent dihydroxyacetone kinase, phosphoryl donor subunit DhaM Escherichia coli (strain K12)
Q89B03 0.000838 38 36 2 72 3 ptsH Phosphocarrier protein HPr Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS11650
Feature type CDS
Gene npr
Product PTS phosphocarrier protein NPr
Location 482461 - 482733 (strand: -1)
Length 273 (nucleotides) / 90 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000002
Length 573139 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_236
Orthogroup size 8
N. genomes 7

Actions

Genomic region

Domains

PF00381 PTS HPr component phosphorylation site

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1925 Signal transduction mechanisms (T)
Carbohydrate transport and metabolism (G)
TG HPr or related phosphotransfer protein

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K08485 phosphocarrier protein NPr Phosphotransferase system (PTS) -

Protein Sequence

MTIRCQVEIKNRLGLHARPAMKLVELIQTFRSTVIFRNKQNEEARADSVLAMLMLDSEQGSIIEVEATGPDENLAIEAIISLFDSGFDED

Flanking regions ( +/- flanking 50bp)

GTAAAAACGTGCAATCACGTCATCGTACGCTGGAAAAACGGAAATAATCCATGACAATCCGTTGTCAGGTTGAGATTAAAAACCGGCTGGGGCTTCACGCCCGGCCGGCGATGAAATTGGTTGAACTGATCCAGACGTTCCGTTCGACGGTTATCTTTCGCAATAAACAAAACGAAGAAGCCCGCGCAGACAGTGTACTGGCAATGCTGATGCTTGATTCTGAACAGGGCAGTATTATTGAAGTGGAAGCGACAGGGCCTGATGAAAATTTAGCGATTGAGGCAATTATTTCCCTTTTCGATTCAGGTTTTGATGAAGATTAGCTATACTAAACGGAATATTTTACTTAAAAAAAATTGATACGCTGTTTCAC