Homologs in group_813

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_03300 FBDBKF_03300 70.9 Morganella morganii S1 yjgA ribosome biogenesis factor YjgA
EHELCC_07235 EHELCC_07235 70.9 Morganella morganii S2 yjgA ribosome biogenesis factor YjgA
NLDBIP_07560 NLDBIP_07560 70.9 Morganella morganii S4 yjgA ribosome biogenesis factor YjgA
LHKJJB_07095 LHKJJB_07095 70.9 Morganella morganii S3 yjgA ribosome biogenesis factor YjgA
HKOGLL_03835 HKOGLL_03835 70.9 Morganella morganii S5 yjgA ribosome biogenesis factor YjgA
F4V73_RS11635 F4V73_RS11635 68.1 Morganella psychrotolerans yjgA ribosome biogenesis factor YjgA

Distribution of the homologs in the orthogroup group_813

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_813

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4EX40 3.77e-131 368 100 0 186 3 PMI3641 UPF0307 protein PMI3641 Proteus mirabilis (strain HI4320)
Q7N042 4.65e-87 256 74 2 186 3 plu4061 UPF0307 protein plu4061 Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
B2VD05 6.36e-81 241 62 1 185 3 ETA_29350 UPF0307 protein ETA_29350 Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
A8GK41 3.85e-78 234 63 2 187 3 Spro_4387 UPF0307 protein Spro_4387 Serratia proteamaculans (strain 568)
A1JRH2 5.4e-78 233 64 1 184 3 YE3790 UPF0307 protein YE3790 Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q1C1K6 4.32e-77 231 65 1 184 3 YPA_3704 UPF0307 protein YPA_3704 Yersinia pestis bv. Antiqua (strain Antiqua)
Q8ZAU5 4.32e-77 231 65 1 184 3 YPO3691 UPF0307 protein YPO3691/y0172/YP_3853 Yersinia pestis
Q1CDX2 4.32e-77 231 65 1 184 3 YPN_3481 UPF0307 protein YPN_3481 Yersinia pestis bv. Antiqua (strain Nepal516)
A4THF5 4.32e-77 231 65 1 184 3 YPDSF_0298 UPF0307 protein YPDSF_0298 Yersinia pestis (strain Pestoides F)
A9R1V4 4.32e-77 231 65 1 184 3 YpAngola_A1170 UPF0307 protein YpAngola_A1170 Yersinia pestis bv. Antiqua (strain Angola)
B1JKI7 6.2e-77 231 64 1 184 3 YPK_0489 UPF0307 protein YPK_0489 Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
A7FDU0 6.2e-77 231 64 1 184 3 YpsIP31758_0425 UPF0307 protein YpsIP31758_0425 Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
B2K432 6.2e-77 231 64 1 184 3 YPTS_3728 UPF0307 protein YPTS_3728 Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q665H6 6.2e-77 231 64 1 184 3 YPTB3542 UPF0307 protein YPTB3542 Yersinia pseudotuberculosis serotype I (strain IP32953)
Q328V2 8.7e-77 230 62 1 185 3 yjgA UPF0307 protein YjgA Shigella dysenteriae serotype 1 (strain Sd197)
C5BAW4 1.9e-74 224 63 3 188 3 NT01EI_3382 UPF0307 protein NT01EI_3382 Edwardsiella ictaluri (strain 93-146)
B5Y2W8 2.28e-74 224 62 2 187 3 KPK_5034 UPF0307 protein KPK_5034 Klebsiella pneumoniae (strain 342)
A6THE7 2.28e-74 224 62 2 187 3 KPN78578_45570 UPF0307 protein KPN78578_45570 Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
A7MM35 1.31e-72 219 59 2 187 3 ESA_00243 UPF0307 protein ESA_00243 Cronobacter sakazakii (strain ATCC BAA-894)
Q3YUB7 1.54e-72 219 63 2 187 3 yjgA UPF0307 protein YjgA Shigella sonnei (strain Ss046)
B7LMQ3 1.54e-72 219 63 2 187 3 yjgA UPF0307 protein YjgA Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q1R322 1.54e-72 219 63 2 187 3 yjgA UPF0307 protein YjgA Escherichia coli (strain UTI89 / UPEC)
B1LRB8 1.54e-72 219 63 2 187 3 yjgA UPF0307 protein YjgA Escherichia coli (strain SMS-3-5 / SECEC)
B6I2E6 1.54e-72 219 63 2 187 3 yjgA UPF0307 protein YjgA Escherichia coli (strain SE11)
B7NGG7 1.54e-72 219 63 2 187 3 yjgA UPF0307 protein YjgA Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A8X0 1.54e-72 219 63 2 187 1 yjgA UPF0307 protein YjgA Escherichia coli (strain K12)
B1ISX1 1.54e-72 219 63 2 187 3 yjgA UPF0307 protein YjgA Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
Q0T9F5 1.54e-72 219 63 2 187 3 yjgA UPF0307 protein YjgA Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AJD9 1.54e-72 219 63 2 187 3 yjgA UPF0307 protein YjgA Escherichia coli O1:K1 / APEC
A8A7Y9 1.54e-72 219 63 2 187 3 yjgA UPF0307 protein YjgA Escherichia coli O9:H4 (strain HS)
B1XEL6 1.54e-72 219 63 2 187 3 yjgA UPF0307 protein YjgA Escherichia coli (strain K12 / DH10B)
C4ZRA8 1.54e-72 219 63 2 187 3 yjgA UPF0307 protein YjgA Escherichia coli (strain K12 / MC4100 / BW2952)
B7M9J4 1.54e-72 219 63 2 187 3 yjgA UPF0307 protein YjgA Escherichia coli O8 (strain IAI1)
B7MSW9 1.54e-72 219 63 2 187 3 yjgA UPF0307 protein YjgA Escherichia coli O81 (strain ED1a)
B5Z3I9 1.54e-72 219 63 2 187 3 yjgA UPF0307 protein YjgA Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A8X1 1.54e-72 219 63 2 187 3 yjgA UPF0307 protein YjgA Escherichia coli O157:H7
B7LCU1 1.54e-72 219 63 2 187 3 yjgA UPF0307 protein YjgA Escherichia coli (strain 55989 / EAEC)
B7MLP2 1.54e-72 219 63 2 187 3 yjgA UPF0307 protein YjgA Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UQP4 1.54e-72 219 63 2 187 3 yjgA UPF0307 protein YjgA Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZVB3 1.54e-72 219 63 2 187 3 yjgA UPF0307 protein YjgA Escherichia coli O139:H28 (strain E24377A / ETEC)
Q31TH0 1.66e-72 219 63 2 187 3 yjgA UPF0307 protein YjgA Shigella boydii serotype 4 (strain Sb227)
B2TZ10 1.66e-72 219 63 2 187 3 yjgA UPF0307 protein YjgA Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q8FAF3 1.15e-71 217 62 2 187 3 yjgA UPF0307 protein YjgA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
B7NUE9 1.36e-71 217 62 2 187 3 yjgA UPF0307 protein YjgA Escherichia coli O7:K1 (strain IAI39 / ExPEC)
Q0SXH6 1.57e-71 217 62 2 187 3 yjgA UPF0307 protein YjgA Shigella flexneri serotype 5b (strain 8401)
A8AMG1 3.93e-71 216 62 2 187 3 CKO_03595 UPF0307 protein CKO_03595 Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q83P53 5.33e-71 216 62 2 187 3 yjgA UPF0307 protein YjgA Shigella flexneri
Q6DAH2 1.76e-70 214 61 2 186 3 ECA0281 UPF0307 protein ECA0281 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
C6DIM5 3.65e-70 213 60 2 186 3 PC1_0266 UPF0307 protein PC1_0266 Pectobacterium carotovorum subsp. carotovorum (strain PC1)
B5BKN6 9.78e-70 213 61 2 187 3 yjgA UPF0307 protein YjgA Salmonella paratyphi A (strain AKU_12601)
Q5PJ90 9.78e-70 213 61 2 187 3 yjgA UPF0307 protein YjgA Salmonella paratyphi A (strain ATCC 9150 / SARB42)
P60829 1.1e-69 212 61 2 187 3 yjgA UPF0307 protein YjgA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P60828 1.1e-69 212 61 2 187 3 yjgA UPF0307 protein YjgA Salmonella typhi
B4TT59 1.1e-69 212 61 2 187 3 yjgA UPF0307 protein YjgA Salmonella schwarzengrund (strain CVM19633)
C0Q6I8 1.1e-69 212 61 2 187 3 yjgA UPF0307 protein YjgA Salmonella paratyphi C (strain RKS4594)
A9N578 1.1e-69 212 61 2 187 3 yjgA UPF0307 protein YjgA Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B4T3I1 1.1e-69 212 61 2 187 3 yjgA UPF0307 protein YjgA Salmonella newport (strain SL254)
B4TFG2 1.1e-69 212 61 2 187 3 yjgA UPF0307 protein YjgA Salmonella heidelberg (strain SL476)
B5R0U6 1.1e-69 212 61 2 187 3 yjgA UPF0307 protein YjgA Salmonella enteritidis PT4 (strain P125109)
B5FSC9 1.1e-69 212 61 2 187 3 yjgA UPF0307 protein YjgA Salmonella dublin (strain CT_02021853)
Q57GG5 1.1e-69 212 61 2 187 3 yjgA UPF0307 protein YjgA Salmonella choleraesuis (strain SC-B67)
B5F3G6 1.1e-69 212 61 2 187 3 yjgA UPF0307 protein YjgA Salmonella agona (strain SL483)
B5R9H6 2.08e-69 211 61 2 187 3 yjgA UPF0307 protein YjgA Salmonella gallinarum (strain 287/91 / NCTC 13346)
A4W5X9 7.15e-69 210 60 2 187 3 Ent638_0421 UPF0307 protein Ent638_0421 Enterobacter sp. (strain 638)
A9MEY0 1.49e-68 209 60 2 187 3 yjgA UPF0307 protein YjgA Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B8F3W5 2.26e-65 201 64 0 158 3 HAPS_0332 UPF0307 protein HAPS_0332 Glaesserella parasuis serovar 5 (strain SH0165)
B3GXG6 8.97e-65 199 63 0 158 3 APP7_0773 UPF0307 protein APP7_0773 Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
B0BP10 8.97e-65 199 63 0 158 3 APJL_0732 UPF0307 protein APJL_0732 Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
A3N094 8.97e-65 199 63 0 158 3 APL_0730 UPF0307 protein APL_0730 Actinobacillus pleuropneumoniae serotype 5b (strain L20)
B0UW94 2.37e-64 199 62 0 162 3 HSM_0289 UPF0307 protein HSM_0289 Histophilus somni (strain 2336)
Q0I4Q7 2.89e-64 198 62 0 162 3 HS_1326 UPF0307 protein HS_1326 Histophilus somni (strain 129Pt)
Q2NWN5 2.1e-63 196 60 2 185 3 SG0165 UPF0307 protein SG0165 Sodalis glossinidius (strain morsitans)
Q65US2 3.09e-63 196 58 1 170 3 MS0681 UPF0307 protein MS0681 Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q9CPC8 1.26e-62 194 64 2 169 3 PM0119 UPF0307 protein PM0119 Pasteurella multocida (strain Pm70)
A5UIS4 8.21e-61 189 58 0 162 3 CGSHiGG_09420 UPF0307 protein CGSHiGG_09420 Haemophilus influenzae (strain PittGG)
A5UCV6 8.21e-61 189 58 0 162 3 CGSHiEE_06290 UPF0307 protein CGSHiEE_06290 Haemophilus influenzae (strain PittEE)
P45076 8.21e-61 189 58 0 162 3 HI_1151 UPF0307 protein HI_1151 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q8DE96 3.49e-60 188 59 0 164 3 VV1_0700 UPF0307 protein VV1_0700 Vibrio vulnificus (strain CMCP6)
Q7MPC4 3.49e-60 188 59 0 164 3 VV0440 UPF0307 protein VV0440 Vibrio vulnificus (strain YJ016)
Q7VLR0 6.13e-60 187 58 1 168 3 HD_1362 UPF0307 protein HD_1362 Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q4QLE5 1.39e-59 186 57 0 160 3 NTHI1319 UPF0307 protein NTHI1319 Haemophilus influenzae (strain 86-028NP)
A6VMI2 6.18e-59 185 57 2 173 3 Asuc_0809 UPF0307 protein Asuc_0809 Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
B7VKW1 2.61e-56 178 56 0 160 3 VS_2764 UPF0307 protein VS_2764 Vibrio atlanticus (strain LGP32)
Q87LD5 8.1e-55 174 58 0 162 3 VP2677 UPF0307 protein VP2677 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
A7MSA8 6.04e-54 172 56 0 162 3 VIBHAR_03672 UPF0307 protein VIBHAR_03672 Vibrio campbellii (strain ATCC BAA-1116)
Q5E7X1 6.62e-52 167 57 0 154 3 VF_0380 UPF0307 protein VF_0380 Aliivibrio fischeri (strain ATCC 700601 / ES114)
B5F9M4 6.62e-52 167 57 0 154 3 VFMJ11_0371 UPF0307 protein VFMJ11_0371 Aliivibrio fischeri (strain MJ11)
Q9KP43 2.17e-49 161 56 0 153 3 VC_2536 UPF0307 protein VC_2536 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A0KQ25 2.64e-42 142 48 1 152 3 AHA_3937 UPF0307 protein AHA_3937 Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
A4SHW3 1.74e-41 140 48 1 152 3 ASA_0301 UPF0307 protein ASA_0301 Aeromonas salmonicida (strain A449)
Q5P7P8 1.16e-39 136 45 3 172 3 AZOSEA05410 UPF0307 protein AZOSEA05410 Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q0HZF8 1.31e-38 133 46 2 164 3 Shewmr7_0494 UPF0307 protein Shewmr7_0494 Shewanella sp. (strain MR-7)
A0L1D3 1.31e-38 133 46 2 164 3 Shewana3_3632 UPF0307 protein Shewana3_3632 Shewanella sp. (strain ANA-3)
Q5R0H4 3.4e-37 129 43 1 163 3 IL0389 UPF0307 protein IL0389 Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q8EA30 3.87e-37 129 47 1 153 3 SO_4079 UPF0307 protein SO_4079 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q0HEJ5 7.66e-37 129 45 2 164 3 Shewmr4_3456 UPF0307 protein Shewmr4_3456 Shewanella sp. (strain MR-4)
Q7NT63 5.88e-35 124 46 2 154 3 CV_3198 UPF0307 protein CV_3198 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q9JV11 2.63e-33 119 41 3 164 3 NMA1049 UPF0307 protein NMA1049 Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
C1DQ47 5.61e-33 119 43 1 155 3 Avin_12730 UPF0307 protein Avin_12730 Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
Q4KI98 5.01e-32 116 44 1 155 3 PFL_0904 UPF0307 protein PFL_0904 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
B1JDN1 1.07e-31 115 42 1 154 3 PputW619_4274 UPF0307 protein PputW619_4274 Pseudomonas putida (strain W619)
Q0AI71 1.62e-31 115 44 2 152 3 Neut_0689 UPF0307 protein Neut_0689 Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
A5VZ32 3.18e-31 114 42 1 154 3 Pput_0981 UPF0307 protein Pput_0981 Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q88PA9 3.18e-31 114 42 1 154 3 PP_0941 UPF0307 protein PP_0941 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q9JZZ2 5.35e-31 113 38 3 165 3 NMB0840 UPF0307 protein NMB0840 Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q1H3T4 6.88e-31 113 38 2 165 3 Mfla_0583 UPF0307 protein Mfla_0583 Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
Q1IEC3 2.34e-30 112 40 1 155 3 PSEEN1082 UPF0307 protein PSEEN1082 Pseudomonas entomophila (strain L48)
B0KQH0 2.52e-30 112 41 1 154 3 PputGB1_0948 UPF0307 protein PputGB1_0948 Pseudomonas putida (strain GB-1)
B7V012 2.95e-30 112 41 1 155 3 PLES_48521 UPF0307 protein PLES_48521 Pseudomonas aeruginosa (strain LESB58)
Q9HVU8 2.95e-30 112 41 1 155 3 PA4473 UPF0307 protein PA4473 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
A6VBI8 6.84e-30 110 40 1 155 3 PSPA7_5087 UPF0307 protein PSPA7_5087 Pseudomonas aeruginosa (strain PA7)
Q82SV5 9.76e-30 110 43 2 152 3 NE2194 UPF0307 protein NE2194 Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
A4XQL6 1.69e-29 110 38 2 175 3 Pmen_0864 UPF0307 protein Pmen_0864 Pseudomonas mendocina (strain ymp)
Q3SGZ3 1.71e-29 110 41 2 156 3 Tbd_2147 UPF0307 protein Tbd_2147 Thiobacillus denitrificans (strain ATCC 25259)
Q2Y6B8 2.33e-29 109 43 2 157 3 Nmul_A2414 UPF0307 protein Nmul_A2414 Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
Q2P0P6 2.67e-29 110 36 2 167 3 XOO3126 UPF0307 protein XOO3126 Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
B2SWF4 2.67e-29 110 36 2 167 3 PXO_01892 UPF0307 protein PXO_01892 Xanthomonas oryzae pv. oryzae (strain PXO99A)
B2FP40 3.68e-29 109 38 2 165 3 Smlt3470 UPF0307 protein Smlt3470 Stenotrophomonas maltophilia (strain K279a)
Q8PIX9 4.2e-29 109 37 2 167 3 XAC2766 UPF0307 protein XAC2766 Xanthomonas axonopodis pv. citri (strain 306)
Q5GXL3 7.74e-29 108 36 2 167 3 XOO3304 UPF0307 protein XOO3304 Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
Q8P7K6 8.44e-29 108 36 2 167 3 XCC2605 UPF0307 protein XCC2605 Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RR22 8.44e-29 108 36 2 167 3 xcc-b100_1557 UPF0307 protein xcc-b100_1557 Xanthomonas campestris pv. campestris (strain B100)
Q4UWJ4 8.44e-29 108 36 2 167 3 XC_1511 UPF0307 protein XC_1511 Xanthomonas campestris pv. campestris (strain 8004)
Q3KI17 8.62e-29 108 42 1 155 3 Pfl01_0846 UPF0307 protein Pfl01_0846 Pseudomonas fluorescens (strain Pf0-1)
B4SR01 1.63e-28 108 37 2 165 3 Smal_2897 UPF0307 protein Smal_2897 Stenotrophomonas maltophilia (strain R551-3)
Q3BRG1 3.34e-28 107 36 2 167 3 XCV2921 UPF0307 protein XCV2921 Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q1LK78 3.84e-28 107 39 3 161 3 Rmet_2571 UPF0307 protein Rmet_2571 Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q87WS9 7.31e-28 105 42 1 154 1 PSPTO_4464 UPF0307 protein PSPTO_4464 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q8Y0U9 1.17e-27 106 41 3 162 3 RSc0944 UPF0307 protein RSc0944 Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q13VG0 1.49e-27 105 38 4 154 3 Bxeno_A3391 UPF0307 protein Bxeno_A3391 Paraburkholderia xenovorans (strain LB400)
B4EAM5 5.61e-27 104 37 3 153 3 BceJ2315_28530 UPF0307 protein BceJ2315_28530 Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
Q1BXZ3 9.58e-27 103 36 3 166 3 Bcen_0601 UPF0307 protein Bcen_0601 Burkholderia orbicola (strain AU 1054)
A0K5Q6 9.58e-27 103 36 3 166 3 Bcen2424_1080 UPF0307 protein Bcen2424_1080 Burkholderia cenocepacia (strain HI2424)
B1JXV4 9.82e-27 103 36 3 166 3 Bcenmc03_1039 UPF0307 protein Bcenmc03_1039 Burkholderia orbicola (strain MC0-3)
Q2KUZ3 2.03e-26 102 40 3 162 3 BAV2974 UPF0307 protein BAV2974 Bordetella avium (strain 197N)
B1YV68 4.07e-26 102 36 3 158 3 BamMC406_0960 UPF0307 protein BamMC406_0960 Burkholderia ambifaria (strain MC40-6)
Q39IC5 8.25e-26 101 35 3 159 3 Bcep18194_A4194 UPF0307 protein Bcep18194_A4194 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q473Z4 3.96e-25 99 38 3 153 3 Reut_A0910 UPF0307 protein Reut_A0910 Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q9PE98 7.13e-23 93 34 2 164 3 XF_1130 UPF0307 protein XF_1130 Xylella fastidiosa (strain 9a5c)
Q7WFC0 5.08e-22 90 40 5 176 3 BB4360 UPF0307 protein BB4360 Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q7W3Y8 5.08e-22 90 40 5 176 3 BPP3887 UPF0307 protein BPP3887 Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7VUV5 1.59e-21 89 39 5 176 3 BP2965 UPF0307 protein BP2965 Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q87E99 5.4e-21 88 32 2 164 3 PD_0419 UPF0307 protein PD_0419 Xylella fastidiosa (strain Temecula1 / ATCC 700964)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS18115
Feature type CDS
Gene yjgA
Product ribosome biogenesis factor YjgA
Location 3980378 - 3980938 (strand: -1)
Length 561 (nucleotides) / 186 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_813
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF04751 Protein of unknown function (DUF615)

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3028 Translation, ribosomal structure and biogenesis (J) J Ribosomal 50S subunit-associated protein YjgA, DUF615 family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K09889 ribosome-associated protein - -

Protein Sequence

MAKQPEEWHYLNPEFDNTPLEEEEEEEIIWVSKSEIKRDAEALKKLGTELVELSAQELERVPLDEKLLASIKLAQKVQREARRRQIQYIGKLLRNVDEEPIRQALDKLKNRHNQQILVLHKLEDLRTRLIDGGNEVIEEVVALYPMADRQQLRTLIRNAKKEKEANKPPKSFRLLFQYLKDLSESA

Flanking regions ( +/- flanking 50bp)

TCATTCACCAAATCACACTCCCGGCTTACTCTGCAACAGGAATTTTTATTATGGCAAAGCAGCCAGAAGAGTGGCACTACCTCAATCCTGAATTTGACAATACACCGTTAGAAGAGGAAGAAGAGGAAGAGATCATTTGGGTCAGCAAAAGTGAAATTAAACGTGATGCTGAAGCGTTAAAGAAATTAGGCACCGAACTTGTTGAGTTAAGTGCTCAAGAGCTTGAACGTGTTCCTCTTGATGAAAAACTACTCGCTTCAATTAAATTGGCGCAAAAGGTACAACGCGAAGCGCGTCGTCGCCAAATTCAATATATCGGTAAGTTACTCCGTAATGTTGATGAAGAGCCGATCCGCCAAGCACTAGATAAACTAAAAAATCGCCATAATCAGCAAATTTTAGTGTTACATAAACTAGAAGATCTGCGTACACGTCTGATTGACGGTGGTAATGAAGTGATTGAGGAAGTGGTAGCGCTTTATCCTATGGCCGATCGCCAGCAATTACGCACACTTATTCGTAATGCTAAAAAAGAGAAAGAAGCCAATAAACCGCCAAAATCATTCCGCTTATTGTTTCAATATCTAAAAGATCTCTCAGAGTCAGCTTAACGACTGATGCTCCTGAAAACGCAGTGCTAAATCATGATACCACTGCGGTT