Homologs in group_813

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_07235 EHELCC_07235 100.0 Morganella morganii S2 yjgA ribosome biogenesis factor YjgA
NLDBIP_07560 NLDBIP_07560 100.0 Morganella morganii S4 yjgA ribosome biogenesis factor YjgA
LHKJJB_07095 LHKJJB_07095 100.0 Morganella morganii S3 yjgA ribosome biogenesis factor YjgA
HKOGLL_03835 HKOGLL_03835 100.0 Morganella morganii S5 yjgA ribosome biogenesis factor YjgA
F4V73_RS11635 F4V73_RS11635 90.1 Morganella psychrotolerans yjgA ribosome biogenesis factor YjgA
PMI_RS18115 PMI_RS18115 70.9 Proteus mirabilis HI4320 yjgA ribosome biogenesis factor YjgA

Distribution of the homologs in the orthogroup group_813

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_813

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q7N042 1.91e-88 259 74 1 182 3 plu4061 UPF0307 protein plu4061 Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
C5BAW4 2.29e-83 247 70 1 182 3 NT01EI_3382 UPF0307 protein NT01EI_3382 Edwardsiella ictaluri (strain 93-146)
B2VD05 1.15e-82 245 68 2 182 3 ETA_29350 UPF0307 protein ETA_29350 Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
A8GK41 2.99e-82 244 70 2 184 3 Spro_4387 UPF0307 protein Spro_4387 Serratia proteamaculans (strain 568)
A1JRH2 4.52e-81 241 68 2 182 3 YE3790 UPF0307 protein YE3790 Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q1C1K6 4.16e-79 236 67 2 182 3 YPA_3704 UPF0307 protein YPA_3704 Yersinia pestis bv. Antiqua (strain Antiqua)
Q8ZAU5 4.16e-79 236 67 2 182 3 YPO3691 UPF0307 protein YPO3691/y0172/YP_3853 Yersinia pestis
Q1CDX2 4.16e-79 236 67 2 182 3 YPN_3481 UPF0307 protein YPN_3481 Yersinia pestis bv. Antiqua (strain Nepal516)
A4THF5 4.16e-79 236 67 2 182 3 YPDSF_0298 UPF0307 protein YPDSF_0298 Yersinia pestis (strain Pestoides F)
A9R1V4 4.16e-79 236 67 2 182 3 YpAngola_A1170 UPF0307 protein YpAngola_A1170 Yersinia pestis bv. Antiqua (strain Angola)
B1JKI7 4.9e-79 236 67 2 182 3 YPK_0489 UPF0307 protein YPK_0489 Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
A7FDU0 4.9e-79 236 67 2 182 3 YpsIP31758_0425 UPF0307 protein YpsIP31758_0425 Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
B2K432 4.9e-79 236 67 2 182 3 YPTS_3728 UPF0307 protein YPTS_3728 Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q665H6 4.9e-79 236 67 2 182 3 YPTB3542 UPF0307 protein YPTB3542 Yersinia pseudotuberculosis serotype I (strain IP32953)
Q328V2 1.42e-78 234 68 2 182 3 yjgA UPF0307 protein YjgA Shigella dysenteriae serotype 1 (strain Sd197)
B4EX40 2.18e-78 234 69 2 186 3 PMI3641 UPF0307 protein PMI3641 Proteus mirabilis (strain HI4320)
Q6DAH2 8.42e-77 230 67 0 182 3 ECA0281 UPF0307 protein ECA0281 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
B5BKN6 1.68e-76 229 69 0 181 3 yjgA UPF0307 protein YjgA Salmonella paratyphi A (strain AKU_12601)
Q5PJ90 1.68e-76 229 69 0 181 3 yjgA UPF0307 protein YjgA Salmonella paratyphi A (strain ATCC 9150 / SARB42)
P60829 1.71e-76 229 69 0 181 3 yjgA UPF0307 protein YjgA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P60828 1.71e-76 229 69 0 181 3 yjgA UPF0307 protein YjgA Salmonella typhi
B4TT59 1.71e-76 229 69 0 181 3 yjgA UPF0307 protein YjgA Salmonella schwarzengrund (strain CVM19633)
C0Q6I8 1.71e-76 229 69 0 181 3 yjgA UPF0307 protein YjgA Salmonella paratyphi C (strain RKS4594)
A9N578 1.71e-76 229 69 0 181 3 yjgA UPF0307 protein YjgA Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B4T3I1 1.71e-76 229 69 0 181 3 yjgA UPF0307 protein YjgA Salmonella newport (strain SL254)
B4TFG2 1.71e-76 229 69 0 181 3 yjgA UPF0307 protein YjgA Salmonella heidelberg (strain SL476)
B5R0U6 1.71e-76 229 69 0 181 3 yjgA UPF0307 protein YjgA Salmonella enteritidis PT4 (strain P125109)
B5FSC9 1.71e-76 229 69 0 181 3 yjgA UPF0307 protein YjgA Salmonella dublin (strain CT_02021853)
Q57GG5 1.71e-76 229 69 0 181 3 yjgA UPF0307 protein YjgA Salmonella choleraesuis (strain SC-B67)
B5F3G6 1.71e-76 229 69 0 181 3 yjgA UPF0307 protein YjgA Salmonella agona (strain SL483)
B5R9H6 1.98e-76 229 70 2 182 3 yjgA UPF0307 protein YjgA Salmonella gallinarum (strain 287/91 / NCTC 13346)
A8AMG1 6.81e-76 228 69 0 181 3 CKO_03595 UPF0307 protein CKO_03595 Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
C6DIM5 1.27e-75 227 65 0 182 3 PC1_0266 UPF0307 protein PC1_0266 Pectobacterium carotovorum subsp. carotovorum (strain PC1)
B5Y2W8 8.62e-75 225 66 0 181 3 KPK_5034 UPF0307 protein KPK_5034 Klebsiella pneumoniae (strain 342)
A6THE7 8.62e-75 225 66 0 181 3 KPN78578_45570 UPF0307 protein KPN78578_45570 Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Q31TH0 3.17e-74 224 68 0 181 3 yjgA UPF0307 protein YjgA Shigella boydii serotype 4 (strain Sb227)
B2TZ10 3.17e-74 224 68 0 181 3 yjgA UPF0307 protein YjgA Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q3YUB7 3.28e-74 224 68 0 181 3 yjgA UPF0307 protein YjgA Shigella sonnei (strain Ss046)
B7LMQ3 3.28e-74 224 68 0 181 3 yjgA UPF0307 protein YjgA Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q1R322 3.28e-74 224 68 0 181 3 yjgA UPF0307 protein YjgA Escherichia coli (strain UTI89 / UPEC)
B1LRB8 3.28e-74 224 68 0 181 3 yjgA UPF0307 protein YjgA Escherichia coli (strain SMS-3-5 / SECEC)
B6I2E6 3.28e-74 224 68 0 181 3 yjgA UPF0307 protein YjgA Escherichia coli (strain SE11)
B7NGG7 3.28e-74 224 68 0 181 3 yjgA UPF0307 protein YjgA Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A8X0 3.28e-74 224 68 0 181 1 yjgA UPF0307 protein YjgA Escherichia coli (strain K12)
B1ISX1 3.28e-74 224 68 0 181 3 yjgA UPF0307 protein YjgA Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
Q0T9F5 3.28e-74 224 68 0 181 3 yjgA UPF0307 protein YjgA Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AJD9 3.28e-74 224 68 0 181 3 yjgA UPF0307 protein YjgA Escherichia coli O1:K1 / APEC
A8A7Y9 3.28e-74 224 68 0 181 3 yjgA UPF0307 protein YjgA Escherichia coli O9:H4 (strain HS)
B1XEL6 3.28e-74 224 68 0 181 3 yjgA UPF0307 protein YjgA Escherichia coli (strain K12 / DH10B)
C4ZRA8 3.28e-74 224 68 0 181 3 yjgA UPF0307 protein YjgA Escherichia coli (strain K12 / MC4100 / BW2952)
B7M9J4 3.28e-74 224 68 0 181 3 yjgA UPF0307 protein YjgA Escherichia coli O8 (strain IAI1)
B7MSW9 3.28e-74 224 68 0 181 3 yjgA UPF0307 protein YjgA Escherichia coli O81 (strain ED1a)
B5Z3I9 3.28e-74 224 68 0 181 3 yjgA UPF0307 protein YjgA Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A8X1 3.28e-74 224 68 0 181 3 yjgA UPF0307 protein YjgA Escherichia coli O157:H7
B7LCU1 3.28e-74 224 68 0 181 3 yjgA UPF0307 protein YjgA Escherichia coli (strain 55989 / EAEC)
B7MLP2 3.28e-74 224 68 0 181 3 yjgA UPF0307 protein YjgA Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UQP4 3.28e-74 224 68 0 181 3 yjgA UPF0307 protein YjgA Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZVB3 3.28e-74 224 68 0 181 3 yjgA UPF0307 protein YjgA Escherichia coli O139:H28 (strain E24377A / ETEC)
Q8FAF3 3.9e-74 223 68 0 181 3 yjgA UPF0307 protein YjgA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A9MEY0 4.17e-74 223 67 0 181 3 yjgA UPF0307 protein YjgA Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q0SXH6 6.38e-74 223 68 0 181 3 yjgA UPF0307 protein YjgA Shigella flexneri serotype 5b (strain 8401)
Q83P53 2.08e-73 221 68 0 181 3 yjgA UPF0307 protein YjgA Shigella flexneri
B7NUE9 3.33e-73 221 67 0 181 3 yjgA UPF0307 protein YjgA Escherichia coli O7:K1 (strain IAI39 / ExPEC)
A7MM35 4.94e-73 221 66 0 181 3 ESA_00243 UPF0307 protein ESA_00243 Cronobacter sakazakii (strain ATCC BAA-894)
A4W5X9 3.72e-71 216 65 0 181 3 Ent638_0421 UPF0307 protein Ent638_0421 Enterobacter sp. (strain 638)
Q2NWN5 3.38e-68 208 63 2 182 3 SG0165 UPF0307 protein SG0165 Sodalis glossinidius (strain morsitans)
B3GXG6 9.53e-64 197 64 1 163 3 APP7_0773 UPF0307 protein APP7_0773 Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
B0BP10 9.53e-64 197 64 1 163 3 APJL_0732 UPF0307 protein APJL_0732 Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
A3N094 9.53e-64 197 64 1 163 3 APL_0730 UPF0307 protein APL_0730 Actinobacillus pleuropneumoniae serotype 5b (strain L20)
Q0I4Q7 1.22e-63 196 58 1 178 3 HS_1326 UPF0307 protein HS_1326 Histophilus somni (strain 129Pt)
B0UW94 2.19e-63 196 58 1 178 3 HSM_0289 UPF0307 protein HSM_0289 Histophilus somni (strain 2336)
Q65US2 6.64e-60 187 58 4 181 3 MS0681 UPF0307 protein MS0681 Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
B8F3W5 8.95e-58 182 59 0 158 3 HAPS_0332 UPF0307 protein HAPS_0332 Glaesserella parasuis serovar 5 (strain SH0165)
A5UIS4 1.88e-56 178 57 0 162 3 CGSHiGG_09420 UPF0307 protein CGSHiGG_09420 Haemophilus influenzae (strain PittGG)
A5UCV6 1.88e-56 178 57 0 162 3 CGSHiEE_06290 UPF0307 protein CGSHiEE_06290 Haemophilus influenzae (strain PittEE)
P45076 1.88e-56 178 57 0 162 3 HI_1151 UPF0307 protein HI_1151 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q7VLR0 3.71e-56 177 59 0 158 3 HD_1362 UPF0307 protein HD_1362 Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q8DE96 3.74e-56 178 54 0 164 3 VV1_0700 UPF0307 protein VV1_0700 Vibrio vulnificus (strain CMCP6)
Q7MPC4 3.74e-56 178 54 0 164 3 VV0440 UPF0307 protein VV0440 Vibrio vulnificus (strain YJ016)
Q9CPC8 1.09e-55 176 60 1 155 3 PM0119 UPF0307 protein PM0119 Pasteurella multocida (strain Pm70)
A6VMI2 1.38e-55 176 54 3 181 3 Asuc_0809 UPF0307 protein Asuc_0809 Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
Q4QLE5 6.67e-55 174 56 0 162 3 NTHI1319 UPF0307 protein NTHI1319 Haemophilus influenzae (strain 86-028NP)
Q87LD5 3.79e-53 170 55 0 162 3 VP2677 UPF0307 protein VP2677 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
A7MSA8 1.93e-52 168 53 0 162 3 VIBHAR_03672 UPF0307 protein VIBHAR_03672 Vibrio campbellii (strain ATCC BAA-1116)
B7VKW1 1.91e-51 166 52 0 160 3 VS_2764 UPF0307 protein VS_2764 Vibrio atlanticus (strain LGP32)
A4SHW3 5.3e-51 164 53 3 167 3 ASA_0301 UPF0307 protein ASA_0301 Aeromonas salmonicida (strain A449)
Q5E7X1 7.4e-50 161 54 0 152 3 VF_0380 UPF0307 protein VF_0380 Aliivibrio fischeri (strain ATCC 700601 / ES114)
B5F9M4 7.4e-50 161 54 0 152 3 VFMJ11_0371 UPF0307 protein VFMJ11_0371 Aliivibrio fischeri (strain MJ11)
A0KQ25 1.55e-49 161 54 1 152 3 AHA_3937 UPF0307 protein AHA_3937 Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q9KP43 1.16e-47 156 55 0 153 3 VC_2536 UPF0307 protein VC_2536 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q5R0H4 1.94e-43 145 50 2 163 3 IL0389 UPF0307 protein IL0389 Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q7NT63 9.63e-39 133 49 2 160 3 CV_3198 UPF0307 protein CV_3198 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q9JV11 2.2e-37 129 45 3 164 3 NMA1049 UPF0307 protein NMA1049 Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q0HZF8 3.46e-37 129 46 1 153 3 Shewmr7_0494 UPF0307 protein Shewmr7_0494 Shewanella sp. (strain MR-7)
A0L1D3 3.46e-37 129 46 1 153 3 Shewana3_3632 UPF0307 protein Shewana3_3632 Shewanella sp. (strain ANA-3)
Q8EA30 2.71e-36 127 45 1 153 3 SO_4079 UPF0307 protein SO_4079 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q0HEJ5 3.12e-36 127 45 1 153 3 Shewmr4_3456 UPF0307 protein Shewmr4_3456 Shewanella sp. (strain MR-4)
Q9JZZ2 8.18e-35 123 43 3 165 3 NMB0840 UPF0307 protein NMB0840 Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q5P7P8 5.77e-34 121 45 3 171 3 AZOSEA05410 UPF0307 protein AZOSEA05410 Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q1LK78 8.06e-32 116 41 4 174 3 Rmet_2571 UPF0307 protein Rmet_2571 Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q3SGZ3 5.03e-31 114 40 2 173 3 Tbd_2147 UPF0307 protein Tbd_2147 Thiobacillus denitrificans (strain ATCC 25259)
Q82SV5 1.12e-30 112 42 2 152 3 NE2194 UPF0307 protein NE2194 Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q0AI71 2.38e-30 112 41 2 152 3 Neut_0689 UPF0307 protein Neut_0689 Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
Q1H3T4 4.75e-30 111 38 2 156 3 Mfla_0583 UPF0307 protein Mfla_0583 Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
B7V012 8.79e-30 110 39 1 165 3 PLES_48521 UPF0307 protein PLES_48521 Pseudomonas aeruginosa (strain LESB58)
Q9HVU8 8.79e-30 110 39 1 165 3 PA4473 UPF0307 protein PA4473 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
A6VBI8 5.62e-29 108 40 1 155 3 PSPA7_5087 UPF0307 protein PSPA7_5087 Pseudomonas aeruginosa (strain PA7)
Q3KI17 9.33e-29 107 42 1 155 3 Pfl01_0846 UPF0307 protein Pfl01_0846 Pseudomonas fluorescens (strain Pf0-1)
Q1IEC3 2.53e-28 106 38 1 155 3 PSEEN1082 UPF0307 protein PSEEN1082 Pseudomonas entomophila (strain L48)
A5VZ32 2.76e-28 106 38 1 154 3 Pput_0981 UPF0307 protein Pput_0981 Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q88PA9 2.76e-28 106 38 1 154 3 PP_0941 UPF0307 protein PP_0941 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
B1JDN1 4.24e-28 106 38 1 154 3 PputW619_4274 UPF0307 protein PputW619_4274 Pseudomonas putida (strain W619)
C1DQ47 5.01e-28 105 41 1 155 3 Avin_12730 UPF0307 protein Avin_12730 Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
B0KQH0 5.98e-28 105 38 1 154 3 PputGB1_0948 UPF0307 protein PputGB1_0948 Pseudomonas putida (strain GB-1)
Q8Y0U9 1.04e-27 106 42 3 163 3 RSc0944 UPF0307 protein RSc0944 Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q2Y6B8 1.19e-27 105 42 2 157 3 Nmul_A2414 UPF0307 protein Nmul_A2414 Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
Q13VG0 1.63e-27 105 39 3 153 3 Bxeno_A3391 UPF0307 protein Bxeno_A3391 Paraburkholderia xenovorans (strain LB400)
Q5GXL3 2.47e-27 104 38 2 168 3 XOO3304 UPF0307 protein XOO3304 Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
Q3BRG1 3.6e-27 104 38 2 168 3 XCV2921 UPF0307 protein XCV2921 Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q4KI98 5.93e-27 103 40 1 155 3 PFL_0904 UPF0307 protein PFL_0904 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
A4XQL6 6.29e-27 103 39 1 161 3 Pmen_0864 UPF0307 protein Pmen_0864 Pseudomonas mendocina (strain ymp)
Q2P0P6 6.56e-27 103 38 2 168 3 XOO3126 UPF0307 protein XOO3126 Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
B2SWF4 6.56e-27 103 38 2 168 3 PXO_01892 UPF0307 protein PXO_01892 Xanthomonas oryzae pv. oryzae (strain PXO99A)
B4EAM5 7.53e-27 103 39 3 163 3 BceJ2315_28530 UPF0307 protein BceJ2315_28530 Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
Q8P7K6 8.39e-27 103 38 2 168 3 XCC2605 UPF0307 protein XCC2605 Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RR22 8.39e-27 103 38 2 168 3 xcc-b100_1557 UPF0307 protein xcc-b100_1557 Xanthomonas campestris pv. campestris (strain B100)
Q4UWJ4 8.39e-27 103 38 2 168 3 XC_1511 UPF0307 protein XC_1511 Xanthomonas campestris pv. campestris (strain 8004)
Q8PIX9 9.86e-27 103 38 2 168 3 XAC2766 UPF0307 protein XAC2766 Xanthomonas axonopodis pv. citri (strain 306)
Q473Z4 2.29e-26 102 39 4 169 3 Reut_A0910 UPF0307 protein Reut_A0910 Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q1BXZ3 2.96e-26 102 39 3 163 3 Bcen_0601 UPF0307 protein Bcen_0601 Burkholderia orbicola (strain AU 1054)
A0K5Q6 2.96e-26 102 39 3 163 3 Bcen2424_1080 UPF0307 protein Bcen2424_1080 Burkholderia cenocepacia (strain HI2424)
B2FP40 2.99e-26 102 37 2 166 3 Smlt3470 UPF0307 protein Smlt3470 Stenotrophomonas maltophilia (strain K279a)
B1JXV4 3.04e-26 102 39 3 163 3 Bcenmc03_1039 UPF0307 protein Bcenmc03_1039 Burkholderia orbicola (strain MC0-3)
Q39IC5 4.01e-26 102 37 3 169 3 Bcep18194_A4194 UPF0307 protein Bcep18194_A4194 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
B4SR01 7.62e-26 100 37 2 166 3 Smal_2897 UPF0307 protein Smal_2897 Stenotrophomonas maltophilia (strain R551-3)
Q87WS9 1.01e-25 100 40 1 154 1 PSPTO_4464 UPF0307 protein PSPTO_4464 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
B1YV68 9.41e-25 98 41 4 153 3 BamMC406_0960 UPF0307 protein BamMC406_0960 Burkholderia ambifaria (strain MC40-6)
Q2KUZ3 6.67e-24 95 40 4 162 3 BAV2974 UPF0307 protein BAV2974 Bordetella avium (strain 197N)
Q7VUV5 3.54e-22 91 42 4 169 3 BP2965 UPF0307 protein BP2965 Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7WFC0 8.58e-22 90 42 4 169 3 BB4360 UPF0307 protein BB4360 Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q7W3Y8 8.58e-22 90 42 4 169 3 BPP3887 UPF0307 protein BPP3887 Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q9PE98 5.35e-18 80 34 2 164 3 XF_1130 UPF0307 protein XF_1130 Xylella fastidiosa (strain 9a5c)
Q87E99 2.02e-16 76 33 2 164 3 PD_0419 UPF0307 protein PD_0419 Xylella fastidiosa (strain Temecula1 / ATCC 700964)

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_03300
Feature type CDS
Gene yjgA
Product ribosome biogenesis factor YjgA
Location 60020 - 60568 (strand: 1)
Length 549 (nucleotides) / 182 (amino acids)
In genomic island -

Contig

Accession contig_3
Length 210665 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_813
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF04751 Protein of unknown function (DUF615)

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3028 Translation, ribosomal structure and biogenesis (J) J Ribosomal 50S subunit-associated protein YjgA, DUF615 family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K09889 ribosome-associated protein - -

Protein Sequence

MAKQPEDWFEEPDALPQEEEDDEIIWVSKSEIKRDAEVLKKLGAELVALSKTQLERIPLDEQLLEAILLAQKIKREGLRRQLQLIGKLLRARDPEPITTALDKLKNRHNQQVVLLHKLEDLRERLVTGDDTVTEEAVALFPHLDRQQLRALIRNAKKEREGNKPPKAYRQLFQYLKELAESA

Flanking regions ( +/- flanking 50bp)

GAGATCATCCGGCACCCGCCGCTCTGTGTTTCGCCACAGGAAATACTATTATGGCAAAGCAGCCTGAAGACTGGTTTGAAGAACCCGATGCACTTCCTCAGGAGGAAGAGGATGACGAGATAATCTGGGTCAGCAAAAGCGAAATCAAACGCGATGCTGAAGTCCTGAAAAAACTCGGCGCTGAACTGGTTGCACTGAGCAAAACCCAGCTGGAACGTATTCCGCTGGATGAACAACTGCTCGAAGCCATCCTGCTTGCACAAAAAATCAAGCGCGAAGGTCTGCGCCGTCAGTTACAGCTCATCGGTAAACTGCTGCGGGCCCGTGACCCGGAGCCGATTACCACGGCACTCGACAAACTGAAAAACCGCCATAACCAGCAGGTTGTCCTGCTGCATAAACTCGAAGATCTGCGCGAACGCCTGGTCACCGGTGATGACACCGTGACGGAAGAAGCCGTTGCGCTGTTCCCGCACCTTGATCGCCAGCAGCTGCGTGCGCTTATCCGTAATGCGAAAAAAGAGCGCGAAGGCAATAAACCGCCGAAAGCTTACCGCCAGCTGTTCCAGTATCTGAAAGAACTGGCAGAAAGCGCTTAATCCGCCGTCATGGTCAGGGGGGTCAGCACCAGCTGAATATCCCCCGGCCA