Homologs in group_813

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_03300 FBDBKF_03300 90.1 Morganella morganii S1 yjgA ribosome biogenesis factor YjgA
EHELCC_07235 EHELCC_07235 90.1 Morganella morganii S2 yjgA ribosome biogenesis factor YjgA
NLDBIP_07560 NLDBIP_07560 90.1 Morganella morganii S4 yjgA ribosome biogenesis factor YjgA
LHKJJB_07095 LHKJJB_07095 90.1 Morganella morganii S3 yjgA ribosome biogenesis factor YjgA
HKOGLL_03835 HKOGLL_03835 90.1 Morganella morganii S5 yjgA ribosome biogenesis factor YjgA
PMI_RS18115 PMI_RS18115 68.1 Proteus mirabilis HI4320 yjgA ribosome biogenesis factor YjgA

Distribution of the homologs in the orthogroup group_813

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_813

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q7N042 1.76e-84 249 70 1 182 3 plu4061 UPF0307 protein plu4061 Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A1JRH2 2.44e-80 239 69 2 181 3 YE3790 UPF0307 protein YE3790 Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
A8GK41 3.58e-80 239 69 2 183 3 Spro_4387 UPF0307 protein Spro_4387 Serratia proteamaculans (strain 568)
C5BAW4 7.23e-80 238 68 1 182 3 NT01EI_3382 UPF0307 protein NT01EI_3382 Edwardsiella ictaluri (strain 93-146)
B2VD05 2.71e-79 236 67 2 182 3 ETA_29350 UPF0307 protein ETA_29350 Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
B1JKI7 2.92e-78 234 67 2 181 3 YPK_0489 UPF0307 protein YPK_0489 Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
A7FDU0 2.92e-78 234 67 2 181 3 YpsIP31758_0425 UPF0307 protein YpsIP31758_0425 Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
B2K432 2.92e-78 234 67 2 181 3 YPTS_3728 UPF0307 protein YPTS_3728 Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q665H6 2.92e-78 234 67 2 181 3 YPTB3542 UPF0307 protein YPTB3542 Yersinia pseudotuberculosis serotype I (strain IP32953)
Q1C1K6 1.72e-77 232 66 2 181 3 YPA_3704 UPF0307 protein YPA_3704 Yersinia pestis bv. Antiqua (strain Antiqua)
Q8ZAU5 1.72e-77 232 66 2 181 3 YPO3691 UPF0307 protein YPO3691/y0172/YP_3853 Yersinia pestis
Q1CDX2 1.72e-77 232 66 2 181 3 YPN_3481 UPF0307 protein YPN_3481 Yersinia pestis bv. Antiqua (strain Nepal516)
A4THF5 1.72e-77 232 66 2 181 3 YPDSF_0298 UPF0307 protein YPDSF_0298 Yersinia pestis (strain Pestoides F)
A9R1V4 1.72e-77 232 66 2 181 3 YpAngola_A1170 UPF0307 protein YpAngola_A1170 Yersinia pestis bv. Antiqua (strain Angola)
Q328V2 3.82e-77 231 67 4 183 3 yjgA UPF0307 protein YjgA Shigella dysenteriae serotype 1 (strain Sd197)
B5BKN6 3.34e-76 229 70 2 182 3 yjgA UPF0307 protein YjgA Salmonella paratyphi A (strain AKU_12601)
Q5PJ90 3.34e-76 229 70 2 182 3 yjgA UPF0307 protein YjgA Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B5Y2W8 3.69e-76 228 69 2 182 3 KPK_5034 UPF0307 protein KPK_5034 Klebsiella pneumoniae (strain 342)
A6THE7 3.69e-76 228 69 2 182 3 KPN78578_45570 UPF0307 protein KPN78578_45570 Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
P60829 4.03e-76 228 70 2 182 3 yjgA UPF0307 protein YjgA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P60828 4.03e-76 228 70 2 182 3 yjgA UPF0307 protein YjgA Salmonella typhi
B4TT59 4.03e-76 228 70 2 182 3 yjgA UPF0307 protein YjgA Salmonella schwarzengrund (strain CVM19633)
C0Q6I8 4.03e-76 228 70 2 182 3 yjgA UPF0307 protein YjgA Salmonella paratyphi C (strain RKS4594)
A9N578 4.03e-76 228 70 2 182 3 yjgA UPF0307 protein YjgA Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B4T3I1 4.03e-76 228 70 2 182 3 yjgA UPF0307 protein YjgA Salmonella newport (strain SL254)
B4TFG2 4.03e-76 228 70 2 182 3 yjgA UPF0307 protein YjgA Salmonella heidelberg (strain SL476)
B5R0U6 4.03e-76 228 70 2 182 3 yjgA UPF0307 protein YjgA Salmonella enteritidis PT4 (strain P125109)
B5FSC9 4.03e-76 228 70 2 182 3 yjgA UPF0307 protein YjgA Salmonella dublin (strain CT_02021853)
Q57GG5 4.03e-76 228 70 2 182 3 yjgA UPF0307 protein YjgA Salmonella choleraesuis (strain SC-B67)
B5F3G6 4.03e-76 228 70 2 182 3 yjgA UPF0307 protein YjgA Salmonella agona (strain SL483)
A9MEY0 1.27e-75 227 70 2 182 3 yjgA UPF0307 protein YjgA Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B5R9H6 2.01e-75 226 70 2 182 3 yjgA UPF0307 protein YjgA Salmonella gallinarum (strain 287/91 / NCTC 13346)
B4EX40 2.7e-75 226 67 3 186 3 PMI3641 UPF0307 protein PMI3641 Proteus mirabilis (strain HI4320)
A8AMG1 4.55e-74 223 67 0 181 3 CKO_03595 UPF0307 protein CKO_03595 Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q8FAF3 2.43e-73 221 68 2 182 3 yjgA UPF0307 protein YjgA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q31TH0 2.53e-73 221 68 2 182 3 yjgA UPF0307 protein YjgA Shigella boydii serotype 4 (strain Sb227)
B2TZ10 2.53e-73 221 68 2 182 3 yjgA UPF0307 protein YjgA Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q3YUB7 2.8e-73 221 68 2 182 3 yjgA UPF0307 protein YjgA Shigella sonnei (strain Ss046)
B7LMQ3 2.8e-73 221 68 2 182 3 yjgA UPF0307 protein YjgA Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q1R322 2.8e-73 221 68 2 182 3 yjgA UPF0307 protein YjgA Escherichia coli (strain UTI89 / UPEC)
B1LRB8 2.8e-73 221 68 2 182 3 yjgA UPF0307 protein YjgA Escherichia coli (strain SMS-3-5 / SECEC)
B6I2E6 2.8e-73 221 68 2 182 3 yjgA UPF0307 protein YjgA Escherichia coli (strain SE11)
B7NGG7 2.8e-73 221 68 2 182 3 yjgA UPF0307 protein YjgA Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A8X0 2.8e-73 221 68 2 182 1 yjgA UPF0307 protein YjgA Escherichia coli (strain K12)
B1ISX1 2.8e-73 221 68 2 182 3 yjgA UPF0307 protein YjgA Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
Q0T9F5 2.8e-73 221 68 2 182 3 yjgA UPF0307 protein YjgA Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AJD9 2.8e-73 221 68 2 182 3 yjgA UPF0307 protein YjgA Escherichia coli O1:K1 / APEC
A8A7Y9 2.8e-73 221 68 2 182 3 yjgA UPF0307 protein YjgA Escherichia coli O9:H4 (strain HS)
B1XEL6 2.8e-73 221 68 2 182 3 yjgA UPF0307 protein YjgA Escherichia coli (strain K12 / DH10B)
C4ZRA8 2.8e-73 221 68 2 182 3 yjgA UPF0307 protein YjgA Escherichia coli (strain K12 / MC4100 / BW2952)
B7M9J4 2.8e-73 221 68 2 182 3 yjgA UPF0307 protein YjgA Escherichia coli O8 (strain IAI1)
B7MSW9 2.8e-73 221 68 2 182 3 yjgA UPF0307 protein YjgA Escherichia coli O81 (strain ED1a)
B5Z3I9 2.8e-73 221 68 2 182 3 yjgA UPF0307 protein YjgA Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A8X1 2.8e-73 221 68 2 182 3 yjgA UPF0307 protein YjgA Escherichia coli O157:H7
B7LCU1 2.8e-73 221 68 2 182 3 yjgA UPF0307 protein YjgA Escherichia coli (strain 55989 / EAEC)
B7MLP2 2.8e-73 221 68 2 182 3 yjgA UPF0307 protein YjgA Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UQP4 2.8e-73 221 68 2 182 3 yjgA UPF0307 protein YjgA Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZVB3 2.8e-73 221 68 2 182 3 yjgA UPF0307 protein YjgA Escherichia coli O139:H28 (strain E24377A / ETEC)
Q0SXH6 3.12e-73 221 68 2 182 3 yjgA UPF0307 protein YjgA Shigella flexneri serotype 5b (strain 8401)
Q83P53 1.02e-72 220 68 2 182 3 yjgA UPF0307 protein YjgA Shigella flexneri
B7NUE9 2.78e-72 219 67 2 182 3 yjgA UPF0307 protein YjgA Escherichia coli O7:K1 (strain IAI39 / ExPEC)
Q6DAH2 3.42e-72 218 65 0 182 3 ECA0281 UPF0307 protein ECA0281 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
C6DIM5 4.01e-71 216 63 0 182 3 PC1_0266 UPF0307 protein PC1_0266 Pectobacterium carotovorum subsp. carotovorum (strain PC1)
A7MM35 5.11e-71 216 65 0 181 3 ESA_00243 UPF0307 protein ESA_00243 Cronobacter sakazakii (strain ATCC BAA-894)
A4W5X9 7.49e-71 215 66 2 182 3 Ent638_0421 UPF0307 protein Ent638_0421 Enterobacter sp. (strain 638)
Q2NWN5 8.36e-66 202 63 4 183 3 SG0165 UPF0307 protein SG0165 Sodalis glossinidius (strain morsitans)
B3GXG6 1.65e-63 196 65 1 163 3 APP7_0773 UPF0307 protein APP7_0773 Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
B0BP10 1.65e-63 196 65 1 163 3 APJL_0732 UPF0307 protein APJL_0732 Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
A3N094 1.65e-63 196 65 1 163 3 APL_0730 UPF0307 protein APL_0730 Actinobacillus pleuropneumoniae serotype 5b (strain L20)
Q0I4Q7 3.29e-61 190 57 1 178 3 HS_1326 UPF0307 protein HS_1326 Histophilus somni (strain 129Pt)
B0UW94 5.45e-61 190 60 0 162 3 HSM_0289 UPF0307 protein HSM_0289 Histophilus somni (strain 2336)
Q65US2 1.54e-59 186 58 2 168 3 MS0681 UPF0307 protein MS0681 Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
B8F3W5 2.97e-59 186 59 0 158 3 HAPS_0332 UPF0307 protein HAPS_0332 Glaesserella parasuis serovar 5 (strain SH0165)
A6VMI2 3.02e-58 183 57 1 170 3 Asuc_0809 UPF0307 protein Asuc_0809 Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
A5UIS4 4.86e-57 180 57 0 162 3 CGSHiGG_09420 UPF0307 protein CGSHiGG_09420 Haemophilus influenzae (strain PittGG)
A5UCV6 4.86e-57 180 57 0 162 3 CGSHiEE_06290 UPF0307 protein CGSHiEE_06290 Haemophilus influenzae (strain PittEE)
P45076 4.86e-57 180 57 0 162 3 HI_1151 UPF0307 protein HI_1151 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q7VLR0 3.67e-56 177 60 0 158 3 HD_1362 UPF0307 protein HD_1362 Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q4QLE5 1.48e-55 176 56 0 162 3 NTHI1319 UPF0307 protein NTHI1319 Haemophilus influenzae (strain 86-028NP)
Q9CPC8 2.09e-55 176 58 1 155 3 PM0119 UPF0307 protein PM0119 Pasteurella multocida (strain Pm70)
Q8DE96 1.35e-52 169 53 0 164 3 VV1_0700 UPF0307 protein VV1_0700 Vibrio vulnificus (strain CMCP6)
Q7MPC4 1.35e-52 169 53 0 164 3 VV0440 UPF0307 protein VV0440 Vibrio vulnificus (strain YJ016)
Q87LD5 1e-51 166 54 0 162 3 VP2677 UPF0307 protein VP2677 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
A4SHW3 3.43e-51 165 51 1 173 3 ASA_0301 UPF0307 protein ASA_0301 Aeromonas salmonicida (strain A449)
A7MSA8 5.67e-51 164 52 0 162 3 VIBHAR_03672 UPF0307 protein VIBHAR_03672 Vibrio campbellii (strain ATCC BAA-1116)
B7VKW1 6.24e-50 162 52 0 160 3 VS_2764 UPF0307 protein VS_2764 Vibrio atlanticus (strain LGP32)
A0KQ25 3.88e-49 160 49 1 173 3 AHA_3937 UPF0307 protein AHA_3937 Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q5E7X1 2.6e-47 155 53 0 152 3 VF_0380 UPF0307 protein VF_0380 Aliivibrio fischeri (strain ATCC 700601 / ES114)
B5F9M4 2.6e-47 155 53 0 152 3 VFMJ11_0371 UPF0307 protein VFMJ11_0371 Aliivibrio fischeri (strain MJ11)
Q9KP43 2.5e-46 153 54 0 151 3 VC_2536 UPF0307 protein VC_2536 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q5R0H4 1.92e-45 150 52 2 163 3 IL0389 UPF0307 protein IL0389 Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q0HZF8 1.3e-37 130 45 1 153 3 Shewmr7_0494 UPF0307 protein Shewmr7_0494 Shewanella sp. (strain MR-7)
A0L1D3 1.3e-37 130 45 1 153 3 Shewana3_3632 UPF0307 protein Shewana3_3632 Shewanella sp. (strain ANA-3)
Q8EA30 1.24e-36 128 44 1 153 3 SO_4079 UPF0307 protein SO_4079 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q0HEJ5 2.54e-36 127 45 1 153 3 Shewmr4_3456 UPF0307 protein Shewmr4_3456 Shewanella sp. (strain MR-4)
Q7NT63 4.33e-35 124 47 2 160 3 CV_3198 UPF0307 protein CV_3198 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q9JV11 8.29e-35 123 43 3 164 3 NMA1049 UPF0307 protein NMA1049 Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q1H3T4 1.49e-33 120 41 2 155 3 Mfla_0583 UPF0307 protein Mfla_0583 Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
B7V012 5.73e-33 118 41 1 165 3 PLES_48521 UPF0307 protein PLES_48521 Pseudomonas aeruginosa (strain LESB58)
Q9HVU8 5.73e-33 118 41 1 165 3 PA4473 UPF0307 protein PA4473 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
A6VBI8 9.43e-33 118 43 1 155 3 PSPA7_5087 UPF0307 protein PSPA7_5087 Pseudomonas aeruginosa (strain PA7)
Q5P7P8 1.73e-32 117 46 2 152 3 AZOSEA05410 UPF0307 protein AZOSEA05410 Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q9JZZ2 1.82e-32 117 42 3 165 3 NMB0840 UPF0307 protein NMB0840 Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q1LK78 9.07e-32 116 43 4 169 3 Rmet_2571 UPF0307 protein Rmet_2571 Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q1IEC3 6.35e-31 113 41 1 155 3 PSEEN1082 UPF0307 protein PSEEN1082 Pseudomonas entomophila (strain L48)
Q3KI17 1.06e-30 112 44 1 155 3 Pfl01_0846 UPF0307 protein Pfl01_0846 Pseudomonas fluorescens (strain Pf0-1)
B1JDN1 1.19e-30 112 40 1 154 3 PputW619_4274 UPF0307 protein PputW619_4274 Pseudomonas putida (strain W619)
A5VZ32 1.62e-30 112 40 1 154 3 Pput_0981 UPF0307 protein Pput_0981 Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q88PA9 1.62e-30 112 40 1 154 3 PP_0941 UPF0307 protein PP_0941 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
B0KQH0 3.31e-30 111 40 1 154 3 PputGB1_0948 UPF0307 protein PputGB1_0948 Pseudomonas putida (strain GB-1)
C1DQ47 3.51e-30 111 42 1 155 3 Avin_12730 UPF0307 protein Avin_12730 Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
Q0AI71 4.7e-30 111 40 2 152 3 Neut_0689 UPF0307 protein Neut_0689 Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
Q3SGZ3 8.06e-30 110 44 2 151 3 Tbd_2147 UPF0307 protein Tbd_2147 Thiobacillus denitrificans (strain ATCC 25259)
Q13VG0 2.56e-29 110 41 3 153 3 Bxeno_A3391 UPF0307 protein Bxeno_A3391 Paraburkholderia xenovorans (strain LB400)
A4XQL6 3.39e-29 108 40 1 161 3 Pmen_0864 UPF0307 protein Pmen_0864 Pseudomonas mendocina (strain ymp)
Q4KI98 6.64e-29 108 42 1 155 3 PFL_0904 UPF0307 protein PFL_0904 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
B2FP40 7.5e-29 108 38 2 166 3 Smlt3470 UPF0307 protein Smlt3470 Stenotrophomonas maltophilia (strain K279a)
Q82SV5 7.5e-29 108 39 2 152 3 NE2194 UPF0307 protein NE2194 Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
B4SR01 2.35e-28 107 38 2 166 3 Smal_2897 UPF0307 protein Smal_2897 Stenotrophomonas maltophilia (strain R551-3)
Q8Y0U9 3.24e-28 107 42 3 163 3 RSc0944 UPF0307 protein RSc0944 Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q8P7K6 1.52e-27 105 37 2 168 3 XCC2605 UPF0307 protein XCC2605 Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RR22 1.52e-27 105 37 2 168 3 xcc-b100_1557 UPF0307 protein xcc-b100_1557 Xanthomonas campestris pv. campestris (strain B100)
Q4UWJ4 1.52e-27 105 37 2 168 3 XC_1511 UPF0307 protein XC_1511 Xanthomonas campestris pv. campestris (strain 8004)
Q3BRG1 1.85e-27 105 38 2 168 3 XCV2921 UPF0307 protein XCV2921 Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q39IC5 3.35e-27 104 39 3 169 3 Bcep18194_A4194 UPF0307 protein Bcep18194_A4194 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
B4EAM5 5.52e-27 104 39 3 163 3 BceJ2315_28530 UPF0307 protein BceJ2315_28530 Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
Q2P0P6 6.42e-27 103 36 2 168 3 XOO3126 UPF0307 protein XOO3126 Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
B2SWF4 6.42e-27 103 36 2 168 3 PXO_01892 UPF0307 protein PXO_01892 Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q87WS9 7.12e-27 103 42 1 154 1 PSPTO_4464 UPF0307 protein PSPTO_4464 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q8PIX9 7.46e-27 103 37 2 168 3 XAC2766 UPF0307 protein XAC2766 Xanthomonas axonopodis pv. citri (strain 306)
Q1BXZ3 1.02e-26 103 40 3 163 3 Bcen_0601 UPF0307 protein Bcen_0601 Burkholderia orbicola (strain AU 1054)
A0K5Q6 1.02e-26 103 40 3 163 3 Bcen2424_1080 UPF0307 protein Bcen2424_1080 Burkholderia cenocepacia (strain HI2424)
B1JXV4 1.04e-26 103 40 3 163 3 Bcenmc03_1039 UPF0307 protein Bcenmc03_1039 Burkholderia orbicola (strain MC0-3)
B1YV68 1.51e-26 102 40 3 158 3 BamMC406_0960 UPF0307 protein BamMC406_0960 Burkholderia ambifaria (strain MC40-6)
Q5GXL3 1.98e-26 102 36 2 168 3 XOO3304 UPF0307 protein XOO3304 Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
Q473Z4 2.55e-26 102 38 5 177 3 Reut_A0910 UPF0307 protein Reut_A0910 Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q2Y6B8 7.52e-26 100 40 2 157 3 Nmul_A2414 UPF0307 protein Nmul_A2414 Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
Q2KUZ3 1.18e-22 92 40 4 162 3 BAV2974 UPF0307 protein BAV2974 Bordetella avium (strain 197N)
Q7VUV5 7.22e-21 87 40 4 169 3 BP2965 UPF0307 protein BP2965 Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7WFC0 1.96e-20 86 40 4 169 3 BB4360 UPF0307 protein BB4360 Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q7W3Y8 1.96e-20 86 40 4 169 3 BPP3887 UPF0307 protein BPP3887 Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q9PE98 7.22e-20 85 34 2 164 3 XF_1130 UPF0307 protein XF_1130 Xylella fastidiosa (strain 9a5c)
Q87E99 3.55e-18 80 33 2 164 3 PD_0419 UPF0307 protein PD_0419 Xylella fastidiosa (strain Temecula1 / ATCC 700964)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS11635
Feature type CDS
Gene yjgA
Product ribosome biogenesis factor YjgA
Location 479418 - 479966 (strand: -1)
Length 549 (nucleotides) / 182 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000002
Length 573139 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_813
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF04751 Protein of unknown function (DUF615)

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3028 Translation, ribosomal structure and biogenesis (J) J Ribosomal 50S subunit-associated protein YjgA, DUF615 family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K09889 ribosome-associated protein - -

Protein Sequence

MAKQPETWFEEPEALPQEEEDDEIIWVSKSEIKRDAEILKKLGAELVALSKVQLERIPLDEQLLDAILLAQKIKREGLRRQIQLIGKLMRSRDMDPIITALDKLKNRHNQQVVLLHKLEDLRDRLVTGDDSVAEEAIDLFPHLDRQQLRSLIRNAKKEREGNKPPKAYRQLFQYLKELAETA

Flanking regions ( +/- flanking 50bp)

AGATCATCCGGCGTCATGCTGCTCTGTGTTTCGCCACAGGAAATACAATTATGGCAAAGCAGCCTGAAACCTGGTTTGAAGAACCCGAAGCCCTTCCTCAGGAAGAAGAAGACGACGAGATTATCTGGGTCAGCAAAAGCGAAATCAAACGCGATGCGGAAATCCTGAAAAAACTCGGGGCCGAACTGGTTGCGTTAAGTAAAGTACAGCTGGAACGAATTCCGCTGGATGAACAATTACTCGATGCCATTTTGCTGGCACAAAAAATCAAACGTGAAGGCCTTCGCCGTCAGATACAGCTCATCGGTAAACTAATGCGCTCCCGTGACATGGATCCCATCATCACGGCACTGGATAAACTGAAAAACCGTCATAACCAGCAAGTCGTTCTGCTGCACAAGCTGGAAGATCTGCGTGATCGTCTGGTTACCGGTGATGACAGTGTGGCAGAAGAAGCTATCGATCTGTTCCCGCACCTTGATCGTCAGCAACTGCGCTCACTTATCCGTAATGCGAAAAAAGAGCGCGAAGGGAATAAGCCCCCGAAAGCGTACCGCCAGTTGTTCCAGTATCTGAAAGAACTGGCTGAAACCGCTTAATCCGCCCGCATGGTCAGGGGGGTCAGTATCAGCTGAATATCCCCCGGCCA