Homologs in group_754

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_03360 FBDBKF_03360 77.8 Morganella morganii S1 accB acetyl-CoA carboxylase biotin carboxyl carrier protein
EHELCC_07175 EHELCC_07175 77.8 Morganella morganii S2 accB acetyl-CoA carboxylase biotin carboxyl carrier protein
NLDBIP_07500 NLDBIP_07500 77.8 Morganella morganii S4 accB acetyl-CoA carboxylase biotin carboxyl carrier protein
LHKJJB_07035 LHKJJB_07035 77.8 Morganella morganii S3 accB acetyl-CoA carboxylase biotin carboxyl carrier protein
HKOGLL_03895 HKOGLL_03895 77.8 Morganella morganii S5 accB acetyl-CoA carboxylase biotin carboxyl carrier protein
F4V73_RS11570 F4V73_RS11570 75.2 Morganella psychrotolerans accB acetyl-CoA carboxylase biotin carboxyl carrier protein

Distribution of the homologs in the orthogroup group_754

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_754

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0ABE1 5.15e-71 213 69 0 156 3 accB Biotin carboxyl carrier protein of acetyl-CoA carboxylase Shigella flexneri
P0ABD8 5.15e-71 213 69 0 156 1 accB Biotin carboxyl carrier protein of acetyl-CoA carboxylase Escherichia coli (strain K12)
P0ABD9 5.15e-71 213 69 0 156 3 accB Biotin carboxyl carrier protein of acetyl-CoA carboxylase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0ABE0 5.15e-71 213 69 0 156 3 accB Biotin carboxyl carrier protein of acetyl-CoA carboxylase Escherichia coli O157:H7
P43874 8.98e-56 175 67 1 156 1 accB Biotin carboxyl carrier protein of acetyl-CoA carboxylase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P37799 1.33e-48 157 58 0 155 3 accB Biotin carboxyl carrier protein of acetyl-CoA carboxylase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q06881 9.96e-25 97 32 3 180 1 accB Biotin carboxyl carrier protein of acetyl-CoA carboxylase Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q9LLC1 1.32e-23 95 35 4 168 1 BCCP2 Biotin carboxyl carrier protein of acetyl-CoA carboxylase 2, chloroplastic Arabidopsis thaliana
Q42533 4.32e-23 95 54 0 75 1 BCCP1 Biotin carboxyl carrier protein of acetyl-CoA carboxylase 1, chloroplastic Arabidopsis thaliana
Q42783 7.83e-22 91 50 0 74 1 ACCB-1 Biotin carboxyl carrier protein of acetyl-CoA carboxylase, chloroplastic Glycine max
Q1XDK5 6.43e-21 86 30 3 158 3 accB Biotin carboxyl carrier protein of acetyl-CoA carboxylase Neopyropia yezoensis
P49786 2.47e-20 85 33 0 156 1 accB Biotin carboxyl carrier protein of acetyl-CoA carboxylase Bacillus subtilis (strain 168)
Q9PKR5 1.53e-19 83 31 2 160 3 accB Biotin carboxyl carrier protein of acetyl-CoA carboxylase Chlamydia muridarum (strain MoPn / Nigg)
O84125 4.12e-17 76 47 0 76 3 accB Biotin carboxyl carrier protein of acetyl-CoA carboxylase Chlamydia trachomatis serovar D (strain ATCC VR-885 / DSM 19411 / UW-3/Cx)
Q9Z901 3.62e-15 71 29 3 168 3 accB Biotin carboxyl carrier protein of acetyl-CoA carboxylase Chlamydia pneumoniae
Q5XAE6 2.26e-14 69 32 3 158 1 accB Biotin carboxyl carrier protein of acetyl-CoA carboxylase Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P51283 1.11e-13 67 48 0 72 3 accB Biotin carboxyl carrier protein of acetyl-CoA carboxylase Porphyra purpurea
O19918 1.53e-13 67 50 0 64 3 accB Biotin carboxyl carrier protein of acetyl-CoA carboxylase Cyanidium caldarium
I3R7G3 8.07e-08 53 37 1 80 1 pccA Propionyl-CoA carboxylase, biotin carboxylase and biotin-carboxyl carrier subunit Haloferax mediterranei (strain ATCC 33500 / DSM 1411 / JCM 8866 / NBRC 14739 / NCIMB 2177 / R-4)
P05165 9.51e-08 53 45 1 66 1 PCCA Propionyl-CoA carboxylase alpha chain, mitochondrial Homo sapiens
Q5LUF3 7.02e-07 51 45 0 57 1 pccA Propionyl-CoA carboxylase alpha chain Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
Q96RQ3 2.06e-06 49 34 2 90 1 MCCC1 Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial Homo sapiens
P13187 2.67e-06 49 35 1 76 1 oadA Oxaloacetate decarboxylase alpha chain Klebsiella pneumoniae
O27179 2.69e-06 49 43 0 57 1 pycB Pyruvate carboxylase subunit B Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
P0DTA4 3.81e-06 48 40 1 69 1 PCCA Propionyl-CoA carboxylase alpha chain, mitochondrial Sus scrofa
P14882 3.81e-06 48 42 1 66 1 Pcca Propionyl-CoA carboxylase alpha chain, mitochondrial Rattus norvegicus
Q8XGX8 4.25e-06 48 35 1 73 3 oadA1 Oxaloacetate decarboxylase alpha chain Salmonella typhi
D3DJ41 5.08e-06 48 40 0 62 1 cfiA 2-oxoglutarate carboxylase large subunit Hydrogenobacter thermophilus (strain DSM 6534 / IAM 12695 / TK-6)
Q03030 5.4e-06 48 35 1 73 3 oadA1 Oxaloacetate decarboxylase alpha chain Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P29337 3.36e-05 44 39 1 71 3 bcc Biotin carboxyl carrier protein Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q91ZA3 3.78e-05 46 41 1 65 1 Pcca Propionyl-CoA carboxylase alpha chain, mitochondrial Mus musculus
Q9KWU4 6.51e-05 45 38 0 62 1 pyc Pyruvate carboxylase Bacillus subtilis (strain 168)
O54030 0.000138 42 36 1 75 1 mmdC Methylmalonyl-CoA decarboxylase subunit gamma Propionigenium modestum
Q58628 0.000255 43 35 2 82 1 pycB Pyruvate carboxylase subunit B Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q99MR8 0.000286 43 34 1 72 1 Mccc1 Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial Mus musculus
P46392 0.000324 43 32 2 99 3 bccA Biotin-dependent acyl-coenzyme A carboxylase alpha3 subunit Mycobacterium leprae (strain TN)
Q5I0C3 0.000438 42 34 1 72 1 Mccc1 Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial Rattus norvegicus
P96890 0.000629 42 33 1 80 1 accA3 Biotin-dependent acyl-coenzyme A carboxylase alpha3 subunit Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Q9ZAA7 0.000895 40 36 0 61 1 gcdC Glutaconyl-CoA decarboxylase subunit gamma Acidaminococcus fermentans (strain ATCC 25085 / DSM 20731 / CCUG 9996 / CIP 106432 / VR4)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS18050
Feature type CDS
Gene accB
Product acetyl-CoA carboxylase biotin carboxyl carrier protein
Location 3965428 - 3965898 (strand: -1)
Length 471 (nucleotides) / 156 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_754
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00364 Biotin-requiring enzyme

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0511 Lipid transport and metabolism (I) I Biotin carboxyl carrier protein

Kegg Ortholog Annotation(s)

Protein Sequence

MDIRKIKKLIELVEESGISELEISEGEESVRISRNSGVQGQMAPQQYFAAPAAPQPALAAAVAPVAPETPAATATQEISGHVVRSPMVGTFYRSPSPEAKVFVEVGQQVNVGDTLCIVEAMKMMNQIESDKAGVVKSILCQDGDTIEFDDPLFVIE

Flanking regions ( +/- flanking 50bp)

GTCAACCGCTTGTCTTAATAAAAAACATCAAAAGAGTACGGAATCAACTCATGGATATTCGTAAAATTAAAAAACTGATCGAGCTAGTCGAAGAGTCTGGCATTTCTGAACTGGAAATTTCTGAAGGTGAAGAGTCAGTACGCATCAGTCGCAACTCTGGCGTTCAGGGTCAAATGGCTCCTCAGCAATATTTTGCGGCACCAGCAGCACCTCAACCTGCATTAGCAGCTGCTGTGGCACCTGTAGCACCAGAAACACCAGCGGCTACAGCAACGCAAGAAATTAGCGGCCATGTTGTTCGCTCACCAATGGTAGGTACCTTCTATCGTTCACCAAGCCCAGAAGCAAAAGTCTTTGTTGAAGTGGGTCAGCAAGTCAATGTTGGCGATACACTGTGTATCGTTGAAGCAATGAAAATGATGAACCAAATCGAATCTGATAAAGCGGGCGTTGTTAAATCTATCCTTTGCCAAGATGGCGATACTATTGAGTTTGACGATCCACTCTTTGTCATCGAATAACGAGGCAGGCCCATGCTAGAAAAAATCCTCATTGCCAACCGTGGTGAAAT