Homologs in group_825

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_03360 FBDBKF_03360 88.2 Morganella morganii S1 accB acetyl-CoA carboxylase biotin carboxyl carrier protein
EHELCC_07175 EHELCC_07175 88.2 Morganella morganii S2 accB acetyl-CoA carboxylase biotin carboxyl carrier protein
NLDBIP_07500 NLDBIP_07500 88.2 Morganella morganii S4 accB acetyl-CoA carboxylase biotin carboxyl carrier protein
LHKJJB_07035 LHKJJB_07035 88.2 Morganella morganii S3 accB acetyl-CoA carboxylase biotin carboxyl carrier protein
HKOGLL_03895 HKOGLL_03895 88.2 Morganella morganii S5 accB acetyl-CoA carboxylase biotin carboxyl carrier protein
PMI_RS18050 PMI_RS18050 75.2 Proteus mirabilis HI4320 accB acetyl-CoA carboxylase biotin carboxyl carrier protein

Distribution of the homologs in the orthogroup group_825

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_825

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0ABE1 9.58e-74 220 73 2 156 3 accB Biotin carboxyl carrier protein of acetyl-CoA carboxylase Shigella flexneri
P0ABD8 9.58e-74 220 73 2 156 1 accB Biotin carboxyl carrier protein of acetyl-CoA carboxylase Escherichia coli (strain K12)
P0ABD9 9.58e-74 220 73 2 156 3 accB Biotin carboxyl carrier protein of acetyl-CoA carboxylase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0ABE0 9.58e-74 220 73 2 156 3 accB Biotin carboxyl carrier protein of acetyl-CoA carboxylase Escherichia coli O157:H7
P43874 3.39e-53 168 65 1 155 1 accB Biotin carboxyl carrier protein of acetyl-CoA carboxylase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P37799 9.84e-44 144 54 2 157 3 accB Biotin carboxyl carrier protein of acetyl-CoA carboxylase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q42533 8.98e-23 94 56 0 75 1 BCCP1 Biotin carboxyl carrier protein of acetyl-CoA carboxylase 1, chloroplastic Arabidopsis thaliana
Q9LLC1 6.1e-22 91 34 3 163 1 BCCP2 Biotin carboxyl carrier protein of acetyl-CoA carboxylase 2, chloroplastic Arabidopsis thaliana
Q06881 1.29e-21 88 54 0 74 1 accB Biotin carboxyl carrier protein of acetyl-CoA carboxylase Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q1XDK5 2.42e-20 84 32 3 161 3 accB Biotin carboxyl carrier protein of acetyl-CoA carboxylase Neopyropia yezoensis
P49786 3.08e-19 82 46 0 75 1 accB Biotin carboxyl carrier protein of acetyl-CoA carboxylase Bacillus subtilis (strain 168)
Q42783 1.4e-18 82 48 0 74 1 ACCB-1 Biotin carboxyl carrier protein of acetyl-CoA carboxylase, chloroplastic Glycine max
Q5XAE6 5.66e-18 79 35 6 171 1 accB Biotin carboxyl carrier protein of acetyl-CoA carboxylase Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
O84125 1.51e-17 77 38 1 114 3 accB Biotin carboxyl carrier protein of acetyl-CoA carboxylase Chlamydia trachomatis serovar D (strain ATCC VR-885 / DSM 19411 / UW-3/Cx)
Q9PKR5 2.33e-17 77 30 3 162 3 accB Biotin carboxyl carrier protein of acetyl-CoA carboxylase Chlamydia muridarum (strain MoPn / Nigg)
Q9Z901 4.76e-16 73 30 4 163 3 accB Biotin carboxyl carrier protein of acetyl-CoA carboxylase Chlamydia pneumoniae
O19918 1.12e-15 72 37 1 104 3 accB Biotin carboxyl carrier protein of acetyl-CoA carboxylase Cyanidium caldarium
P51283 8.8e-12 62 48 0 72 3 accB Biotin carboxyl carrier protein of acetyl-CoA carboxylase Porphyra purpurea
I3R7G3 1.4e-06 50 43 0 51 1 pccA Propionyl-CoA carboxylase, biotin carboxylase and biotin-carboxyl carrier subunit Haloferax mediterranei (strain ATCC 33500 / DSM 1411 / JCM 8866 / NBRC 14739 / NCIMB 2177 / R-4)
O27179 7.66e-06 47 47 0 51 1 pycB Pyruvate carboxylase subunit B Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
Q99MR8 3.65e-05 45 36 1 72 1 Mccc1 Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial Mus musculus
P29337 5.93e-05 43 39 1 71 3 bcc Biotin carboxyl carrier protein Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q5I0C3 6.23e-05 45 36 1 72 1 Mccc1 Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial Rattus norvegicus
Q96RQ3 8.71e-05 45 34 2 85 1 MCCC1 Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial Homo sapiens
O54030 0.000162 42 37 1 75 1 mmdC Methylmalonyl-CoA decarboxylase subunit gamma Propionigenium modestum
Q19842 0.000194 43 40 1 71 1 pcca-1 Propionyl-CoA carboxylase alpha chain, mitochondrial Caenorhabditis elegans
Q612F5 0.000194 43 40 1 71 3 pcca-1 Propionyl-CoA carboxylase alpha chain, mitochondrial Caenorhabditis briggsae
Q5LUF3 0.000248 43 36 1 73 1 pccA Propionyl-CoA carboxylase alpha chain Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
Q9KWU4 0.000302 43 41 0 51 1 pyc Pyruvate carboxylase Bacillus subtilis (strain 168)
P13187 0.000679 42 32 1 76 1 oadA Oxaloacetate decarboxylase alpha chain Klebsiella pneumoniae
P05165 0.000845 42 37 2 75 1 PCCA Propionyl-CoA carboxylase alpha chain, mitochondrial Homo sapiens

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS11570
Feature type CDS
Gene accB
Product acetyl-CoA carboxylase biotin carboxyl carrier protein
Location 464514 - 464975 (strand: -1)
Length 462 (nucleotides) / 153 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000002
Length 573139 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_825
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00364 Biotin-requiring enzyme

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0511 Lipid transport and metabolism (I) I Biotin carboxyl carrier protein

Kegg Ortholog Annotation(s)

Protein Sequence

MDIRKIKKLIELVEESGISELEISEGEESVRISRALPIQTFAAPQQYIPQVQQPALANAVAPSQGLADSVAEKEIAGHVVRSPMVGTFYLSPSPDAKPFIHVGKQVNVGDTLCIVEAMKMMNQIEADKAGVVKAILLSDGEPVEFDEPLVVIE

Flanking regions ( +/- flanking 50bp)

GTTCACCGTCTGTCACAACTAACTCAACACTAAGAGTACGGAATCATCTCATGGATATTCGTAAAATAAAAAAACTGATCGAGCTGGTCGAAGAGTCCGGTATTTCTGAGCTGGAAATTTCTGAAGGCGAAGAATCAGTACGCATCAGTCGTGCATTACCGATACAGACTTTTGCCGCACCTCAGCAATATATTCCCCAGGTTCAGCAGCCGGCGTTAGCCAATGCTGTTGCTCCGTCTCAGGGCCTTGCTGACAGTGTTGCGGAAAAAGAAATTGCCGGTCATGTGGTCCGTTCCCCGATGGTAGGTACGTTCTACCTTTCACCAAGTCCGGATGCGAAACCTTTTATCCACGTTGGTAAGCAGGTCAATGTCGGTGATACCCTGTGCATCGTCGAAGCCATGAAAATGATGAACCAGATCGAAGCTGACAAAGCCGGTGTGGTCAAAGCAATTCTGTTAAGCGACGGCGAACCTGTCGAATTTGACGAGCCACTGGTCGTCATCGAATAACGAGGCGAATCATGCTGGAAAAAATCCTTATTGCTAACCGGGGTGAAATT