Homologs in group_754

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_07175 EHELCC_07175 100.0 Morganella morganii S2 accB acetyl-CoA carboxylase biotin carboxyl carrier protein
NLDBIP_07500 NLDBIP_07500 100.0 Morganella morganii S4 accB acetyl-CoA carboxylase biotin carboxyl carrier protein
LHKJJB_07035 LHKJJB_07035 100.0 Morganella morganii S3 accB acetyl-CoA carboxylase biotin carboxyl carrier protein
HKOGLL_03895 HKOGLL_03895 100.0 Morganella morganii S5 accB acetyl-CoA carboxylase biotin carboxyl carrier protein
F4V73_RS11570 F4V73_RS11570 88.2 Morganella psychrotolerans accB acetyl-CoA carboxylase biotin carboxyl carrier protein
PMI_RS18050 PMI_RS18050 77.8 Proteus mirabilis HI4320 accB acetyl-CoA carboxylase biotin carboxyl carrier protein

Distribution of the homologs in the orthogroup group_754

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_754

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0ABE1 9.18e-75 223 76 3 156 3 accB Biotin carboxyl carrier protein of acetyl-CoA carboxylase Shigella flexneri
P0ABD8 9.18e-75 223 76 3 156 1 accB Biotin carboxyl carrier protein of acetyl-CoA carboxylase Escherichia coli (strain K12)
P0ABD9 9.18e-75 223 76 3 156 3 accB Biotin carboxyl carrier protein of acetyl-CoA carboxylase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0ABE0 9.18e-75 223 76 3 156 3 accB Biotin carboxyl carrier protein of acetyl-CoA carboxylase Escherichia coli O157:H7
P43874 5.09e-57 178 71 1 155 1 accB Biotin carboxyl carrier protein of acetyl-CoA carboxylase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P37799 1.16e-44 146 56 1 155 3 accB Biotin carboxyl carrier protein of acetyl-CoA carboxylase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q06881 3.28e-24 95 33 5 180 1 accB Biotin carboxyl carrier protein of acetyl-CoA carboxylase Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q1XDK5 8.59e-24 93 34 2 155 3 accB Biotin carboxyl carrier protein of acetyl-CoA carboxylase Neopyropia yezoensis
Q42533 7.16e-22 91 54 0 75 1 BCCP1 Biotin carboxyl carrier protein of acetyl-CoA carboxylase 1, chloroplastic Arabidopsis thaliana
Q42783 6.01e-21 89 50 0 74 1 ACCB-1 Biotin carboxyl carrier protein of acetyl-CoA carboxylase, chloroplastic Glycine max
Q9LLC1 1.2e-20 87 33 2 162 1 BCCP2 Biotin carboxyl carrier protein of acetyl-CoA carboxylase 2, chloroplastic Arabidopsis thaliana
P49786 1.71e-18 80 33 2 155 1 accB Biotin carboxyl carrier protein of acetyl-CoA carboxylase Bacillus subtilis (strain 168)
O84125 1.63e-17 77 50 0 76 3 accB Biotin carboxyl carrier protein of acetyl-CoA carboxylase Chlamydia trachomatis serovar D (strain ATCC VR-885 / DSM 19411 / UW-3/Cx)
Q5XAE6 1.06e-16 75 34 5 166 1 accB Biotin carboxyl carrier protein of acetyl-CoA carboxylase Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
Q9PKR5 1.79e-16 75 44 0 81 3 accB Biotin carboxyl carrier protein of acetyl-CoA carboxylase Chlamydia muridarum (strain MoPn / Nigg)
Q9Z901 1.11e-15 72 44 0 76 3 accB Biotin carboxyl carrier protein of acetyl-CoA carboxylase Chlamydia pneumoniae
O19918 4.42e-15 70 40 2 103 3 accB Biotin carboxyl carrier protein of acetyl-CoA carboxylase Cyanidium caldarium
P51283 1.3e-14 70 51 0 72 3 accB Biotin carboxyl carrier protein of acetyl-CoA carboxylase Porphyra purpurea
I3R7G3 2.4e-07 52 42 0 54 1 pccA Propionyl-CoA carboxylase, biotin carboxylase and biotin-carboxyl carrier subunit Haloferax mediterranei (strain ATCC 33500 / DSM 1411 / JCM 8866 / NBRC 14739 / NCIMB 2177 / R-4)
P13187 6.69e-06 48 36 1 76 1 oadA Oxaloacetate decarboxylase alpha chain Klebsiella pneumoniae
Q8XGX8 9.61e-06 47 36 1 73 3 oadA1 Oxaloacetate decarboxylase alpha chain Salmonella typhi
Q03030 1.14e-05 47 35 1 73 3 oadA1 Oxaloacetate decarboxylase alpha chain Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q96RQ3 2.21e-05 46 34 1 72 1 MCCC1 Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial Homo sapiens
O27179 4.43e-05 45 45 0 51 1 pycB Pyruvate carboxylase subunit B Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
D3DJ41 5.59e-05 45 40 0 62 1 cfiA 2-oxoglutarate carboxylase large subunit Hydrogenobacter thermophilus (strain DSM 6534 / IAM 12695 / TK-6)
Q99MR8 6.72e-05 45 34 1 72 1 Mccc1 Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial Mus musculus
Q5LUF3 0.000105 44 40 0 57 1 pccA Propionyl-CoA carboxylase alpha chain Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
Q5I0C3 0.000126 44 34 1 72 1 Mccc1 Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial Rattus norvegicus
P05165 0.000134 44 39 1 66 1 PCCA Propionyl-CoA carboxylase alpha chain, mitochondrial Homo sapiens
P14882 0.000185 43 40 1 66 1 Pcca Propionyl-CoA carboxylase alpha chain, mitochondrial Rattus norvegicus
P29337 0.000227 42 38 1 71 3 bcc Biotin carboxyl carrier protein Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q9KWU4 0.000286 43 37 0 62 1 pyc Pyruvate carboxylase Bacillus subtilis (strain 168)
Q612F5 0.00059 42 43 1 65 3 pcca-1 Propionyl-CoA carboxylase alpha chain, mitochondrial Caenorhabditis briggsae
Q19842 0.000629 42 43 1 65 1 pcca-1 Propionyl-CoA carboxylase alpha chain, mitochondrial Caenorhabditis elegans
P0DTA4 0.000673 42 39 1 66 1 PCCA Propionyl-CoA carboxylase alpha chain, mitochondrial Sus scrofa

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_03360
Feature type CDS
Gene accB
Product acetyl-CoA carboxylase biotin carboxyl carrier protein
Location 73837 - 74298 (strand: 1)
Length 462 (nucleotides) / 153 (amino acids)

Contig

Accession contig_3
Length 210665 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_754
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00364 Biotin-requiring enzyme

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0511 Lipid transport and metabolism (I) I Biotin carboxyl carrier protein

Kegg Ortholog Annotation(s)

Protein Sequence

MDIRKIKKLIELVEESGISELEISEGEESVRISRALPVQAMAVPQQYSAPVQQPALAAAVAPSAGLADPAPEKEIAGHVVRSPMVGTFYRSPSPDAKAFIEVGKQVNVGDTLCIVEAMKMMNQIEADKAGVVKAILLKDGDAVEFDEPLVVIE

Flanking regions ( +/- flanking 50bp)

GTTCACCGTCTGTCACAATTAACTCAACACTAAGAGTACGGAATCATCTCATGGATATTCGTAAAATAAAAAAACTGATCGAGCTGGTCGAAGAGTCCGGTATTTCTGAGCTGGAAATTTCTGAAGGCGAAGAGTCAGTACGCATCAGCCGCGCTTTACCGGTTCAGGCTATGGCCGTACCACAGCAATACAGCGCACCTGTTCAGCAGCCAGCTCTGGCAGCCGCTGTTGCACCATCCGCAGGTCTTGCTGATCCGGCGCCGGAAAAAGAGATTGCCGGCCATGTGGTCCGCTCTCCGATGGTGGGTACGTTCTACCGTTCACCAAGCCCGGATGCGAAAGCCTTTATTGAAGTCGGTAAACAGGTCAATGTCGGTGACACCCTGTGCATCGTCGAAGCCATGAAAATGATGAACCAGATCGAAGCTGACAAAGCCGGTGTGGTTAAAGCAATTCTGTTAAAAGACGGCGATGCTGTCGAATTTGACGAGCCACTGGTCGTCATCGAATAACGGGGCGAATCATGCTGGAAAAAATCCTTATTGCCAACCGGGGTGAAATT