Homologs in group_827

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_03375 FBDBKF_03375 87.9 Morganella morganii S1 dusB tRNA dihydrouridine synthase DusB
EHELCC_07160 EHELCC_07160 87.9 Morganella morganii S2 dusB tRNA dihydrouridine synthase DusB
NLDBIP_07485 NLDBIP_07485 87.9 Morganella morganii S4 dusB tRNA dihydrouridine synthase DusB
LHKJJB_07020 LHKJJB_07020 87.9 Morganella morganii S3 dusB tRNA dihydrouridine synthase DusB
HKOGLL_03910 HKOGLL_03910 87.9 Morganella morganii S5 dusB tRNA dihydrouridine synthase DusB
F4V73_RS11555 F4V73_RS11555 88.5 Morganella psychrotolerans dusB tRNA dihydrouridine synthase DusB

Distribution of the homologs in the orthogroup group_827

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_827

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
O52533 0.0 653 96 0 323 3 dusB tRNA-dihydrouridine synthase B Proteus vulgaris
P0A2R6 0.0 585 85 0 320 3 dusB tRNA-dihydrouridine synthase B Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2R7 0.0 585 85 0 320 3 dusB tRNA-dihydrouridine synthase B Salmonella typhi
P0ABT5 0.0 579 84 0 320 1 dusB tRNA-dihydrouridine synthase B Escherichia coli (strain K12)
P0ABT6 0.0 579 84 0 320 3 dusB tRNA-dihydrouridine synthase B Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0ABT7 0.0 579 84 0 320 3 dusB tRNA-dihydrouridine synthase B Escherichia coli O157:H7
Q83PZ5 0.0 577 84 0 320 3 dusB tRNA-dihydrouridine synthase B Shigella flexneri
Q8ZAX7 0.0 576 83 0 320 3 dusB tRNA-dihydrouridine synthase B Yersinia pestis
O52536 0.0 573 83 0 320 3 dusB tRNA-dihydrouridine synthase B Klebsiella pneumoniae
O52539 0.0 559 81 0 320 3 dusB tRNA-dihydrouridine synthase B Pectobacterium carotovorum
O52532 0.0 555 84 0 320 3 dusB tRNA-dihydrouridine synthase B Serratia marcescens
Q87KU1 6e-170 477 70 0 319 3 dusB tRNA-dihydrouridine synthase B Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q8CWL2 1.87e-165 466 71 0 319 3 dusB tRNA-dihydrouridine synthase B Vibrio vulnificus (strain CMCP6)
Q9KV66 2.44e-163 461 71 0 319 3 dusB tRNA-dihydrouridine synthase B Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P44965 1.56e-152 434 62 3 325 3 dusB tRNA-dihydrouridine synthase B Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q7VNP2 2.28e-152 432 64 1 314 3 dusB tRNA-dihydrouridine synthase B Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q8EJR8 3.5e-152 432 65 1 323 3 dusB tRNA-dihydrouridine synthase B Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q9CLW3 5.63e-150 427 61 0 321 3 dusB tRNA-dihydrouridine synthase B Pasteurella multocida (strain Pm70)
Q88DK5 7.32e-135 389 62 0 317 3 dusB tRNA-dihydrouridine synthase B Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q9HUW1 4.6e-134 387 62 0 317 3 dusB tRNA-dihydrouridine synthase B Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q8PCH1 6.52e-125 363 57 0 321 3 dusB tRNA-dihydrouridine synthase B Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q87VS1 2.2e-124 362 60 0 317 3 dusB tRNA-dihydrouridine synthase B Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q8PP72 4.75e-124 361 56 0 321 3 dusB tRNA-dihydrouridine synthase B Xanthomonas axonopodis pv. citri (strain 306)
Q4UNJ4 1.92e-91 278 42 2 325 3 dus Probable tRNA-dihydrouridine synthase Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
Q92JQ6 2.85e-87 268 41 1 322 3 dus Probable tRNA-dihydrouridine synthase Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Q9ZED2 7.14e-87 266 42 2 323 3 dus Probable tRNA-dihydrouridine synthase Rickettsia prowazekii (strain Madrid E)
Q1RH84 5.74e-85 261 43 1 306 3 dus Probable tRNA-dihydrouridine synthase Rickettsia bellii (strain RML369-C)
P45672 1.69e-84 261 43 3 321 3 dus Probable tRNA-dihydrouridine synthase Azospirillum brasilense
Q68XZ3 5.58e-83 256 40 2 323 3 dus Probable tRNA-dihydrouridine synthase Rickettsia typhi (strain ATCC VR-144 / Wilmington)
P41504 5.37e-76 238 45 4 288 3 dus Probable tRNA-dihydrouridine synthase Rhizobium leguminosarum bv. phaseoli
P37567 3.71e-71 226 39 3 318 3 dus1 Probable tRNA-dihydrouridine synthase 1 Bacillus subtilis (strain 168)
Q08111 1.48e-66 214 46 5 284 3 dus Probable tRNA-dihydrouridine synthase Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
Q55724 4.01e-61 201 38 4 323 3 dus1 Probable tRNA-dihydrouridine synthase 1 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P9WNS7 1.98e-47 167 33 4 320 1 dus Probable tRNA-dihydrouridine synthase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WNS6 1.98e-47 167 33 4 320 3 dus Probable tRNA-dihydrouridine synthase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q9ZLB6 9.91e-44 155 34 7 315 3 dus Probable tRNA-dihydrouridine synthase Helicobacter pylori (strain J99 / ATCC 700824)
Q50049 7.26e-43 155 32 6 326 3 dus Probable tRNA-dihydrouridine synthase Mycobacterium leprae (strain TN)
O25427 8.24e-42 150 33 6 315 3 dus Probable tRNA-dihydrouridine synthase Helicobacter pylori (strain ATCC 700392 / 26695)
O83945 2.4e-41 149 34 5 299 3 dus Probable tRNA-dihydrouridine synthase Treponema pallidum (strain Nichols)
P0CN29 1.72e-34 136 34 5 242 3 DUS3 tRNA-dihydrouridine(47) synthase [NAD(P)(+)] Cryptococcus neoformans var. neoformans serotype D (strain B-3501A)
P0CN28 1.97e-34 136 34 5 242 3 DUS3 tRNA-dihydrouridine(47) synthase [NAD(P)(+)] Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)
O67533 2.22e-33 128 33 4 238 3 dus Probable tRNA-dihydrouridine synthase Aquifex aeolicus (strain VF5)
Q8DAH1 6.73e-32 124 30 13 323 3 dusC tRNA-dihydrouridine(16) synthase Vibrio vulnificus (strain CMCP6)
Q87N01 1.78e-31 123 33 6 239 3 dusC tRNA-dihydrouridine(16) synthase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q54CU9 1.88e-31 127 34 5 239 3 dus3l tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like Dictyostelium discoideum
Q8ZGV2 8.76e-31 121 32 7 264 3 dusC tRNA-dihydrouridine(16) synthase Yersinia pestis
Q9KT00 4e-30 119 33 6 239 3 dusC tRNA-dihydrouridine(16) synthase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q8ZNM4 1.04e-29 118 31 6 251 3 dusC tRNA-dihydrouridine(16) synthase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q884C6 1.17e-29 118 32 4 255 3 dusC tRNA-dihydrouridine(16) synthase Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q8FFV5 2.11e-29 117 29 9 323 3 dusC tRNA-dihydrouridine(16) synthase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P33371 2.57e-29 117 29 9 316 1 dusC tRNA-dihydrouridine(16) synthase Escherichia coli (strain K12)
Q8XEC6 3.46e-29 117 28 9 316 3 dusC tRNA-dihydrouridine(16) synthase Escherichia coli O157:H7
Q7UC91 4.67e-29 116 31 7 264 3 dusC tRNA-dihydrouridine(16) synthase Shigella flexneri
Q9JZL5 7.44e-29 116 32 5 248 3 dusC tRNA-dihydrouridine(16) synthase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q8Z5B2 1.25e-28 115 31 6 251 3 dusC tRNA-dihydrouridine(16) synthase Salmonella typhi
Q9HZ95 2.31e-28 114 33 8 227 3 dusC tRNA-dihydrouridine(16) synthase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9CJW1 3.87e-28 114 34 5 230 3 dusC tRNA-dihydrouridine(16) synthase Pasteurella multocida (strain Pm70)
Q7ZWS1 6.08e-28 117 31 6 239 2 dus3l tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like Xenopus laevis
Q9JUP6 7.09e-28 114 32 5 248 3 dusC tRNA-dihydrouridine(16) synthase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q28BT8 7.93e-28 117 32 6 239 2 dus3l tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like Xenopus tropicalis
P44606 3.5e-27 111 31 9 262 3 dusC tRNA-dihydrouridine(16) synthase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A3LUK5 4.01e-27 114 31 7 260 3 DUS3 tRNA-dihydrouridine(47) synthase [NAD(P)(+)] Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545)
Q9T0J6 5.96e-27 114 31 9 290 1 At4g38890 tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like Arabidopsis thaliana
Q88LF2 8.51e-27 110 34 6 227 3 dusC tRNA-dihydrouridine(16) synthase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q8EFG7 9.06e-27 110 30 9 314 3 dusC tRNA-dihydrouridine(16) synthase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q7VKU5 1.16e-26 110 32 5 238 3 dusC tRNA-dihydrouridine(16) synthase Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q9D7B1 1.31e-26 112 30 11 336 1 Dus2 tRNA-dihydrouridine(20) synthase [NAD(P)+]-like Mus musculus
A5DBS1 5.21e-26 111 30 7 260 3 DUS3 tRNA-dihydrouridine(47) synthase [NAD(P)(+)] Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324)
Q4P1U2 1.1e-25 110 32 8 262 3 DUS3 tRNA-dihydrouridine(47) synthase [NAD(P)(+)] Ustilago maydis (strain 521 / FGSC 9021)
Q9NX74 1.12e-25 110 30 10 332 1 DUS2 tRNA-dihydrouridine(20) synthase [NAD(P)+]-like Homo sapiens
Q9AMN9 2.35e-25 106 29 5 273 3 dusC tRNA-dihydrouridine(16) synthase Pseudomonas alcaligenes
Q7XT07 2.53e-25 109 33 6 234 2 Os04g0117600 tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like Oryza sativa subsp. japonica
Q96G46 5.05e-25 108 33 6 233 1 DUS3L tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like Homo sapiens
A8NZY7 5.33e-25 108 30 6 241 3 DUS3 tRNA-dihydrouridine(47) synthase [NAD(P)(+)] Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003)
Q5ALL3 1.29e-24 107 31 6 259 3 DUS3 tRNA-dihydrouridine(47) synthase [NAD(P)(+)] Candida albicans (strain SC5314 / ATCC MYA-2876)
Q91XI1 2.98e-24 106 33 7 233 1 Dus3l tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like Mus musculus
A8PTG4 4.73e-24 106 28 5 262 3 DUS3 tRNA-dihydrouridine(47) synthase [NAD(P)(+)] Malassezia globosa (strain ATCC MYA-4612 / CBS 7966)
O95620 1.09e-23 102 32 6 226 1 DUS4L tRNA-dihydrouridine(20a/20b) synthase [NAD(P)+]-like Homo sapiens
Q3KRC5 1.32e-23 104 32 7 232 2 Dus3l tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like Rattus norvegicus
Q757E3 4.88e-23 103 29 9 303 3 DUS3 tRNA-dihydrouridine(47) synthase [NAD(P)(+)] Eremothecium gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056)
A5DTS1 9.37e-23 102 31 8 262 3 DUS3 tRNA-dihydrouridine(47) synthase [NAD(P)(+)] Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239)
Q6BS64 9.47e-23 102 29 7 260 3 DUS3 tRNA-dihydrouridine(47) synthase [NAD(P)(+)] Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968)
Q6CWM0 1.09e-22 102 32 8 256 3 DUS3 tRNA-dihydrouridine(47) synthase [NAD(P)(+)] Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37)
O68273 2e-22 98 30 8 268 3 dusC tRNA-dihydrouridine(16) synthase Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
P72872 2.21e-22 99 30 9 248 3 dus2 tRNA-dihydrouridine(20/20a) synthase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q1E2F4 1.38e-21 99 29 11 296 3 DUS3 tRNA-dihydrouridine(47) synthase [NAD(P)(+)] Coccidioides immitis (strain RS)
Q8XYX1 1.7e-21 96 32 7 239 3 dusC tRNA-dihydrouridine(16) synthase Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q32M08 2.34e-21 95 28 9 311 2 Dus4l tRNA-dihydrouridine(20a/20b) synthase [NAD(P)+]-like Mus musculus
Q0CZL3 2.7e-21 97 28 8 294 3 dus3 tRNA-dihydrouridine(47) synthase [NAD(P)(+)] Aspergillus terreus (strain NIH 2624 / FGSC A1156)
A7TQ73 3.12e-21 97 29 8 265 3 DUS3 tRNA-dihydrouridine(47) synthase [NAD(P)(+)] Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294 / BCRC 21397 / CBS 2163 / NBRC 10782 / NRRL Y-8283 / UCD 57-17)
Q6FJ14 4.77e-21 97 29 8 269 3 DUS3 tRNA-dihydrouridine(47) synthase [NAD(P)(+)] Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138)
Q06053 5.75e-21 97 29 9 261 1 DUS3 tRNA-dihydrouridine(47) synthase [NAD(P)(+)] Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
A7A1S5 5.75e-21 97 29 9 261 3 DUS3 tRNA-dihydrouridine(47) synthase [NAD(P)(+)] Saccharomyces cerevisiae (strain YJM789)
Q5SMC7 8.25e-21 94 29 5 235 1 dus tRNA-dihydrouridine(20/20a) synthase Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
A1CNY3 1.33e-20 95 29 11 294 3 dus3 tRNA-dihydrouridine(47) synthase [NAD(P)(+)] Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107)
Q09504 2.53e-20 92 33 7 221 3 C45G9.2 Uncharacterized tRNA-dihydrouridine synthase-like protein C45G9.2 Caenorhabditis elegans
Q8EAJ0 4.15e-20 92 28 9 245 3 dusA tRNA-dihydrouridine(20/20a) synthase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
A1D1U0 4.77e-20 94 29 10 293 3 dus3 tRNA-dihydrouridine(47) synthase [NAD(P)(+)] Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181)
Q4WRX4 5.24e-20 94 29 10 293 3 dus3 tRNA-dihydrouridine(47) synthase [NAD(P)(+)] Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
A2QAU6 5.89e-20 94 28 10 295 3 dus3 tRNA-dihydrouridine(47) synthase [NAD(P)(+)] Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513)
Q9KUX9 6.34e-20 92 27 9 318 3 dusA tRNA-dihydrouridine(20/20a) synthase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q2UL89 9.37e-20 93 28 10 300 3 dus3 tRNA-dihydrouridine(47) synthase [NAD(P)(+)] Aspergillus oryzae (strain ATCC 42149 / RIB 40)
A4RLF4 5.18e-19 91 27 10 313 3 DUS3 tRNA-dihydrouridine(47) synthase [NAD(P)(+)] Pyricularia oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)
Q6C4K3 5.96e-19 90 29 7 259 3 DUS3 tRNA-dihydrouridine(47) synthase [NAD(P)(+)] Yarrowia lipolytica (strain CLIB 122 / E 150)
Q5BF62 8.43e-19 90 28 11 293 3 dus3 tRNA-dihydrouridine(47) synthase [NAD(P)(+)] Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Q8P3X4 1.2e-18 88 29 12 325 3 dusA tRNA-dihydrouridine(20/20a) synthase Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q9UTH9 1.61e-18 89 29 9 259 1 dus3 tRNA-dihydrouridine(47) synthase [NAD(P)(+)] Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q8CWK7 2.89e-18 87 28 9 266 3 dusA tRNA-dihydrouridine(20/20a) synthase Vibrio vulnificus (strain CMCP6)
Q9HGN6 6.14e-18 87 28 6 230 1 dus1 tRNA-dihydrouridine(16/17) synthase [NAD(P)(+)] Schizosaccharomyces pombe (strain 972 / ATCC 24843)
O74553 8.23e-18 85 27 3 225 1 dus4 tRNA-dihydrouridine(20a/20b) synthase [NAD(P)+] Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q7SG01 1.08e-17 87 29 11 302 3 dus-3 tRNA-dihydrouridine(47) synthase [NAD(P)(+)] Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
Q87L85 1.33e-17 85 29 8 246 3 dusA tRNA-dihydrouridine(20/20a) synthase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
P53759 2.06e-17 85 29 7 232 1 DUS1 tRNA-dihydrouridine(16/17) synthase [NAD(P)(+)] Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q06063 2.65e-17 85 28 6 228 1 DUS4 tRNA-dihydrouridine(20a/20b) synthase [NAD(P)+] Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P67717 4.72e-17 84 30 7 243 1 dus Probable tRNA-dihydrouridine synthase Staphylococcus aureus (strain N315)
P67716 4.72e-17 84 30 7 243 3 dus Probable tRNA-dihydrouridine synthase Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q6GKK9 4.91e-17 83 30 7 243 3 dus Probable tRNA-dihydrouridine synthase Staphylococcus aureus (strain MRSA252)
Q8NYV4 5.52e-17 83 30 7 243 3 dus Probable tRNA-dihydrouridine synthase Staphylococcus aureus (strain MW2)
Q6GD38 5.52e-17 83 30 7 243 3 dus Probable tRNA-dihydrouridine synthase Staphylococcus aureus (strain MSSA476)
Q5HJT5 5.52e-17 83 30 7 243 3 dus Probable tRNA-dihydrouridine synthase Staphylococcus aureus (strain COL)
A6RMI1 8.21e-17 84 28 11 291 3 dus3 tRNA-dihydrouridine(47) synthase [NAD(P)(+)] Botryotinia fuckeliana (strain B05.10)
Q5HKD5 1.19e-16 82 30 7 242 3 dus Probable tRNA-dihydrouridine synthase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q2HDP2 1.73e-16 83 29 12 295 3 DUS3 tRNA-dihydrouridine(47) synthase [NAD(P)(+)] Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970)
A6QYC6 3.58e-16 82 28 12 296 3 DUS3 tRNA-dihydrouridine(47) synthase [NAD(P)(+)] Ajellomyces capsulatus (strain NAm1 / WU24)
Q0U9D6 3.78e-16 82 26 9 297 3 DUS3 tRNA-dihydrouridine(47) synthase [NAD(P)(+)] Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173)
Q6P1R4 3.82e-16 82 29 5 228 1 DUS1L tRNA-dihydrouridine(16/17) synthase [NAD(P)(+)]-like Homo sapiens
Q8CU07 4.69e-16 80 30 7 242 3 dus Probable tRNA-dihydrouridine synthase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q88KX0 4.96e-16 80 26 7 239 3 dusA tRNA-dihydrouridine(20/20a) synthase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q8K582 5.02e-16 81 28 6 228 2 Dus1l tRNA-dihydrouridine(16/17) synthase [NAD(P)(+)]-like Rattus norvegicus
Q8C2P3 6.35e-16 81 28 6 228 2 Dus1l tRNA-dihydrouridine(16/17) synthase [NAD(P)(+)]-like Mus musculus
A7EKL8 1.17e-15 81 27 10 292 3 dus3 tRNA-dihydrouridine(47) synthase [NAD(P)(+)] Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)
O31546 1.45e-15 79 29 6 232 3 dus2 Probable tRNA-dihydrouridine synthase 2 Bacillus subtilis (strain 168)
Q8PFF8 2.2e-15 79 28 8 284 3 dusA tRNA-dihydrouridine(20/20a) synthase Xanthomonas axonopodis pv. citri (strain 306)
Q9CL29 5.15e-15 77 25 7 259 3 dusA tRNA-dihydrouridine(20/20a) synthase Pasteurella multocida (strain Pm70)
Q9I048 8.84e-15 77 25 7 247 3 dusA tRNA-dihydrouridine(20/20a) synthase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q8ZJ14 2.9e-14 75 27 8 247 3 dusA tRNA-dihydrouridine(20/20a) synthase Yersinia pestis
P44794 2.89e-13 72 26 7 259 3 dusA tRNA-dihydrouridine(20/20a) synthase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q7VNV2 8.63e-13 71 26 9 248 3 dusA tRNA-dihydrouridine(20/20a) synthase Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q884G7 2.14e-12 70 25 8 239 3 dusA tRNA-dihydrouridine(20/20a) synthase Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
O74731 6.6e-12 69 24 9 344 1 dus2 tRNA-dihydrouridine(20) synthase [NAD(P)+] Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q8FB30 1.23e-11 68 25 7 277 3 dusA tRNA-dihydrouridine(20/20a) synthase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P32695 1.47e-11 67 25 7 277 1 dusA tRNA-dihydrouridine(20/20a) synthase Escherichia coli (strain K12)
Q8X5V6 1.47e-11 67 25 7 277 3 dusA tRNA-dihydrouridine(20/20a) synthase Escherichia coli O157:H7
Q7UBC5 2.29e-11 67 27 8 247 3 dusA tRNA-dihydrouridine(20/20a) synthase Shigella flexneri
Q8Z1T1 2.42e-11 67 25 7 266 3 dusA tRNA-dihydrouridine(20/20a) synthase Salmonella typhi
Q8ZKH4 4.35e-11 66 24 6 272 3 dusA tRNA-dihydrouridine(20/20a) synthase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q9PGB5 1.59e-10 64 29 9 241 3 dusA tRNA-dihydrouridine(20/20a) synthase Xylella fastidiosa (strain 9a5c)
Q87AY2 4.49e-10 63 30 10 242 3 dusA tRNA-dihydrouridine(20/20a) synthase Xylella fastidiosa (strain Temecula1 / ATCC 700964)
O27281 1.12e-08 58 30 10 221 3 pyrD Dihydroorotate dehydrogenase B (NAD(+)), catalytic subunit Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
P53720 1.43e-07 56 32 4 143 1 SMM1 tRNA-dihydrouridine(20) synthase [NAD(P)+] Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q8CWG1 1.59e-07 55 28 7 203 3 pyrD Dihydroorotate dehydrogenase B (NAD(+)), catalytic subunit Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
A8FD19 6.56e-07 53 26 11 279 3 pyrD Dihydroorotate dehydrogenase B (NAD(+)), catalytic subunit Bacillus pumilus (strain SAFR-032)
A0RHQ6 1.06e-06 53 28 9 225 3 pyrD Dihydroorotate dehydrogenase B (NAD(+)), catalytic subunit Bacillus thuringiensis (strain Al Hakam)
P54322 1.03e-05 50 29 11 230 1 pyrDB Dihydroorotate dehydrogenase B (NAD(+)), catalytic subunit Lactococcus lactis subsp. cremoris (strain MG1363)
B7GFA1 1.11e-05 50 30 9 200 3 pyrD Dihydroorotate dehydrogenase B (NAD(+)), catalytic subunit Anoxybacillus flavithermus (strain DSM 21510 / WK1)
C5D8Q2 1.34e-05 49 28 8 216 3 pyrD Dihydroorotate dehydrogenase B (NAD(+)), catalytic subunit Geobacillus sp. (strain WCH70)
Q74J29 3.15e-05 48 25 10 208 3 pyrD Dihydroorotate dehydrogenase A (fumarate) Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Q13E39 9.77e-05 46 27 4 137 3 hisA 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase Rhodopseudomonas palustris (strain BisB5)
A1ATI1 0.000136 46 24 4 129 3 hisA 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
Q5L0U1 0.000143 46 31 7 166 3 pyrD Dihydroorotate dehydrogenase B (NAD(+)), catalytic subunit Geobacillus kaustophilus (strain HTA426)
Q9K9W1 0.000144 46 29 8 187 3 pyrD Dihydroorotate dehydrogenase B (NAD(+)), catalytic subunit Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q1QRX1 0.000147 46 31 3 116 3 hisA 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
B3E618 0.00015 46 24 4 129 3 hisA 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)
Q3SWF0 0.00018 45 31 3 117 3 hisA 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
A7Z4H4 0.000233 45 29 5 164 3 pyrD Dihydroorotate dehydrogenase B (NAD(+)), catalytic subunit Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
A8YVZ9 0.000245 45 27 10 210 3 pyrD Dihydroorotate dehydrogenase A (fumarate) Lactobacillus helveticus (strain DPC 4571)
P25996 0.000294 45 27 6 195 1 pyrD Dihydroorotate dehydrogenase B (NAD(+)), catalytic subunit Bacillus subtilis (strain 168)
Q31E65 0.000315 45 24 4 145 3 hisA 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
A5E8E8 0.00032 45 30 3 116 3 hisA 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
B3Q950 0.00034 45 28 3 117 3 hisA 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase Rhodopseudomonas palustris (strain TIE-1)
P60582 0.00034 45 28 3 117 3 hisA 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
A4IM35 0.000341 45 29 8 195 3 pyrD Dihydroorotate dehydrogenase B (NAD(+)), catalytic subunit Geobacillus thermodenitrificans (strain NG80-2)
P46539 0.00036 45 30 7 166 3 pyrD Dihydroorotate dehydrogenase B (NAD(+)), catalytic subunit Bacillus caldolyticus
Q5FJB5 0.000468 45 28 7 155 3 pyrD Dihydroorotate dehydrogenase A (fumarate) Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
A4YJV4 0.000529 44 30 4 118 3 hisA 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase Bradyrhizobium sp. (strain ORS 278)
A6UWA5 0.000554 44 23 5 152 3 hisA 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase Methanococcus aeolicus (strain ATCC BAA-1280 / DSM 17508 / OCM 812 / Nankai-3)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS18025
Feature type CDS
Gene dusB
Product tRNA dihydrouridine synthase DusB
Location 3959954 - 3960925 (strand: -1)
Length 972 (nucleotides) / 323 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_827
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01207 Dihydrouridine synthase (Dus)

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0042 Translation, ribosomal structure and biogenesis (J) J tRNA-dihydrouridine synthase

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K05540 tRNA-dihydrouridine synthase B [EC:1.-.-.-] - -

Protein Sequence

MRIGQYQLKNCLIAAPMAGVTDRPFRSLCYDMGAGMTVSEMLSSNPQVWKTDKSRLRMVHSDELGIRSVQIAGSDPVDMATAAKINVEGGAQIIDINMGCPAKKVNKKLAGSALLRYPDLVAEILSAVVNAVDVPVTLKIRTGWSPDERNCVEIAKLAEDCGIAALTIHGRTRECLFKGEAEYDSIRTVKQSVSIPIIANGDITDPLKARAVLDYTGADALMIGRAAQGRPWIFREIQHYLDTGELLPPLPIAKVQQIMQKHVRELHDFYGQGKGTRIARKHVSWYLKEHAPDDQFRRSFNAIEDASEQLEALEAYFENFLRK

Flanking regions ( +/- flanking 50bp)

ATGCGTAATATACGCGCCCTTGCAGTCACAGTTTGGCCCTCTTTTCATCTATGCGAATCGGACAGTATCAGTTAAAAAATTGCCTCATTGCAGCTCCAATGGCTGGCGTTACAGACCGACCTTTTCGGTCACTTTGCTATGACATGGGTGCGGGGATGACAGTTTCTGAAATGCTTTCTTCTAATCCTCAGGTTTGGAAGACAGACAAGTCTCGGTTACGGATGGTACATAGCGATGAATTGGGGATCCGCTCCGTACAAATTGCGGGAAGTGACCCTGTTGATATGGCTACAGCTGCGAAAATAAACGTAGAAGGTGGCGCTCAGATTATCGACATTAATATGGGTTGTCCGGCAAAAAAGGTGAATAAAAAGTTAGCAGGCTCGGCATTGCTGCGTTATCCGGATTTAGTCGCAGAGATCCTTTCTGCGGTGGTCAATGCGGTTGATGTACCTGTTACACTCAAGATCCGTACAGGATGGTCACCTGATGAACGAAACTGTGTAGAGATTGCCAAATTGGCTGAAGATTGTGGTATTGCGGCTCTCACCATTCATGGACGTACGCGCGAGTGTTTGTTCAAAGGTGAAGCTGAATACGACAGTATTCGGACAGTTAAGCAGAGTGTCTCTATTCCCATTATTGCGAATGGAGACATAACTGACCCGCTAAAAGCCAGAGCAGTGCTTGACTACACTGGAGCCGATGCTTTAATGATCGGTCGCGCTGCTCAGGGAAGACCCTGGATCTTTCGGGAAATCCAGCACTATCTGGACACAGGTGAACTGTTGCCTCCTCTGCCGATTGCAAAGGTGCAACAAATAATGCAAAAGCATGTGCGTGAATTGCACGACTTTTACGGTCAAGGCAAAGGAACTCGCATTGCACGCAAGCATGTCTCTTGGTATCTCAAGGAACATGCCCCTGATGACCAGTTTCGGCGCTCCTTCAACGCCATAGAGGATGCCAGCGAACAGCTGGAGGCGTTGGAAGCATATTTCGAAAATTTTTTGCGTAAATAAATAAAAGAGCTGACAGAACTATGTTCGAACAACGCGTAAATTCAGACGTA