Homologs in group_827

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_03375 FBDBKF_03375 96.6 Morganella morganii S1 dusB tRNA dihydrouridine synthase DusB
EHELCC_07160 EHELCC_07160 96.6 Morganella morganii S2 dusB tRNA dihydrouridine synthase DusB
NLDBIP_07485 NLDBIP_07485 96.6 Morganella morganii S4 dusB tRNA dihydrouridine synthase DusB
LHKJJB_07020 LHKJJB_07020 96.6 Morganella morganii S3 dusB tRNA dihydrouridine synthase DusB
HKOGLL_03910 HKOGLL_03910 96.6 Morganella morganii S5 dusB tRNA dihydrouridine synthase DusB
PMI_RS18025 PMI_RS18025 88.5 Proteus mirabilis HI4320 dusB tRNA dihydrouridine synthase DusB

Distribution of the homologs in the orthogroup group_827

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_827

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
O52533 0.0 598 88 0 323 3 dusB tRNA-dihydrouridine synthase B Proteus vulgaris
P0A2R6 0.0 583 85 0 320 3 dusB tRNA-dihydrouridine synthase B Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2R7 0.0 583 85 0 320 3 dusB tRNA-dihydrouridine synthase B Salmonella typhi
P0ABT5 0.0 580 85 0 320 1 dusB tRNA-dihydrouridine synthase B Escherichia coli (strain K12)
P0ABT6 0.0 580 85 0 320 3 dusB tRNA-dihydrouridine synthase B Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0ABT7 0.0 580 85 0 320 3 dusB tRNA-dihydrouridine synthase B Escherichia coli O157:H7
O52536 0.0 578 85 0 320 3 dusB tRNA-dihydrouridine synthase B Klebsiella pneumoniae
Q83PZ5 0.0 577 85 0 320 3 dusB tRNA-dihydrouridine synthase B Shigella flexneri
Q8ZAX7 0.0 573 85 0 320 3 dusB tRNA-dihydrouridine synthase B Yersinia pestis
O52539 0.0 554 81 0 320 3 dusB tRNA-dihydrouridine synthase B Pectobacterium carotovorum
O52532 0.0 544 84 0 320 3 dusB tRNA-dihydrouridine synthase B Serratia marcescens
Q87KU1 4.4e-165 465 68 0 319 3 dusB tRNA-dihydrouridine synthase B Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q8CWL2 2.61e-160 453 69 0 319 3 dusB tRNA-dihydrouridine synthase B Vibrio vulnificus (strain CMCP6)
Q9KV66 3.84e-158 447 69 0 319 3 dusB tRNA-dihydrouridine synthase B Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P44965 1.58e-149 426 62 2 325 3 dusB tRNA-dihydrouridine synthase B Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q7VNP2 7.27e-148 421 62 1 314 3 dusB tRNA-dihydrouridine synthase B Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q9CLW3 8.17e-148 422 61 0 321 3 dusB tRNA-dihydrouridine synthase B Pasteurella multocida (strain Pm70)
Q8EJR8 2.57e-145 415 64 1 322 3 dusB tRNA-dihydrouridine synthase B Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q88DK5 6.23e-134 387 62 0 317 3 dusB tRNA-dihydrouridine synthase B Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q9HUW1 6.3e-131 379 62 0 317 3 dusB tRNA-dihydrouridine synthase B Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q87VS1 1.57e-124 363 59 0 317 3 dusB tRNA-dihydrouridine synthase B Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q8PCH1 2.08e-119 350 55 0 321 3 dusB tRNA-dihydrouridine synthase B Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q8PP72 2.85e-119 349 54 0 321 3 dusB tRNA-dihydrouridine synthase B Xanthomonas axonopodis pv. citri (strain 306)
Q4UNJ4 6.68e-92 279 43 2 325 3 dus Probable tRNA-dihydrouridine synthase Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
Q92JQ6 1.75e-88 271 42 1 322 3 dus Probable tRNA-dihydrouridine synthase Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Q1RH84 1.16e-86 266 43 3 307 3 dus Probable tRNA-dihydrouridine synthase Rickettsia bellii (strain RML369-C)
Q9ZED2 2.07e-86 265 41 1 322 3 dus Probable tRNA-dihydrouridine synthase Rickettsia prowazekii (strain Madrid E)
Q68XZ3 1.29e-84 261 41 1 322 3 dus Probable tRNA-dihydrouridine synthase Rickettsia typhi (strain ATCC VR-144 / Wilmington)
P45672 1.07e-82 256 43 3 321 3 dus Probable tRNA-dihydrouridine synthase Azospirillum brasilense
P41504 1.14e-74 235 45 4 288 3 dus Probable tRNA-dihydrouridine synthase Rhizobium leguminosarum bv. phaseoli
P37567 3.15e-70 224 39 5 320 3 dus1 Probable tRNA-dihydrouridine synthase 1 Bacillus subtilis (strain 168)
Q08111 2.05e-66 214 45 3 288 3 dus Probable tRNA-dihydrouridine synthase Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
Q55724 8.06e-63 206 39 5 323 3 dus1 Probable tRNA-dihydrouridine synthase 1 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P9WNS7 7.84e-44 157 33 6 321 1 dus Probable tRNA-dihydrouridine synthase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WNS6 7.84e-44 157 33 6 321 3 dus Probable tRNA-dihydrouridine synthase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q9ZLB6 3.93e-41 149 32 7 315 3 dus Probable tRNA-dihydrouridine synthase Helicobacter pylori (strain J99 / ATCC 700824)
O25427 3.49e-40 146 32 6 315 3 dus Probable tRNA-dihydrouridine synthase Helicobacter pylori (strain ATCC 700392 / 26695)
Q50049 4.47e-40 147 33 6 326 3 dus Probable tRNA-dihydrouridine synthase Mycobacterium leprae (strain TN)
O83945 8.43e-38 140 35 5 259 3 dus Probable tRNA-dihydrouridine synthase Treponema pallidum (strain Nichols)
O67533 6.2e-32 124 32 4 238 3 dus Probable tRNA-dihydrouridine synthase Aquifex aeolicus (strain VF5)
P0CN29 7.32e-32 129 34 7 243 3 DUS3 tRNA-dihydrouridine(47) synthase [NAD(P)(+)] Cryptococcus neoformans var. neoformans serotype D (strain B-3501A)
P0CN28 7.6e-32 129 34 7 243 3 DUS3 tRNA-dihydrouridine(47) synthase [NAD(P)(+)] Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)
Q54CU9 1.5e-30 125 33 6 239 3 dus3l tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like Dictyostelium discoideum
Q8DAH1 1.73e-30 120 33 7 239 3 dusC tRNA-dihydrouridine(16) synthase Vibrio vulnificus (strain CMCP6)
Q8ZGV2 1.11e-28 115 32 8 265 3 dusC tRNA-dihydrouridine(16) synthase Yersinia pestis
Q8ZNM4 1.26e-28 115 28 9 321 3 dusC tRNA-dihydrouridine(16) synthase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q9JZL5 3.39e-28 114 32 5 248 3 dusC tRNA-dihydrouridine(16) synthase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q87N01 4.42e-28 114 30 6 244 3 dusC tRNA-dihydrouridine(16) synthase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q9KT00 1.15e-27 113 31 6 240 3 dusC tRNA-dihydrouridine(16) synthase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q9JUP6 2.52e-27 112 32 5 248 3 dusC tRNA-dihydrouridine(16) synthase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q8Z5B2 2.84e-27 111 28 9 321 3 dusC tRNA-dihydrouridine(16) synthase Salmonella typhi
Q9CJW1 1.67e-26 109 34 5 231 3 dusC tRNA-dihydrouridine(16) synthase Pasteurella multocida (strain Pm70)
Q8FFV5 3.05e-26 108 27 9 328 3 dusC tRNA-dihydrouridine(16) synthase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P33371 4.11e-26 108 27 9 321 1 dusC tRNA-dihydrouridine(16) synthase Escherichia coli (strain K12)
Q8XEC6 6.23e-26 108 27 9 321 3 dusC tRNA-dihydrouridine(16) synthase Escherichia coli O157:H7
Q28BT8 6.65e-26 111 31 9 241 2 dus3l tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like Xenopus tropicalis
A3LUK5 7.24e-26 111 31 7 260 3 DUS3 tRNA-dihydrouridine(47) synthase [NAD(P)(+)] Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545)
Q7ZWS1 7.53e-26 111 31 9 241 2 dus3l tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like Xenopus laevis
Q8EFG7 1.1e-25 107 31 12 317 3 dusC tRNA-dihydrouridine(16) synthase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q7UC91 1.18e-25 107 27 9 321 3 dusC tRNA-dihydrouridine(16) synthase Shigella flexneri
P44606 1.6e-25 107 30 8 264 3 dusC tRNA-dihydrouridine(16) synthase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q9T0J6 1.75e-25 110 33 9 250 1 At4g38890 tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like Arabidopsis thaliana
Q884C6 8.84e-25 105 31 4 254 3 dusC tRNA-dihydrouridine(16) synthase Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q9HZ95 9.81e-25 105 30 7 269 3 dusC tRNA-dihydrouridine(16) synthase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
O95620 1.69e-24 104 29 11 319 1 DUS4L tRNA-dihydrouridine(20a/20b) synthase [NAD(P)+]-like Homo sapiens
Q9D7B1 2e-24 106 33 5 245 1 Dus2 tRNA-dihydrouridine(20) synthase [NAD(P)+]-like Mus musculus
A8NZY7 2.48e-24 107 29 7 248 3 DUS3 tRNA-dihydrouridine(47) synthase [NAD(P)(+)] Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003)
Q7VKU5 8.86e-24 102 30 6 263 3 dusC tRNA-dihydrouridine(16) synthase Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q9AMN9 8.98e-24 102 28 7 276 3 dusC tRNA-dihydrouridine(16) synthase Pseudomonas alcaligenes
A8PTG4 1.05e-23 105 28 5 261 3 DUS3 tRNA-dihydrouridine(47) synthase [NAD(P)(+)] Malassezia globosa (strain ATCC MYA-4612 / CBS 7966)
Q9NX74 1.05e-23 104 33 5 245 1 DUS2 tRNA-dihydrouridine(20) synthase [NAD(P)+]-like Homo sapiens
Q4P1U2 1.23e-23 105 30 7 266 3 DUS3 tRNA-dihydrouridine(47) synthase [NAD(P)(+)] Ustilago maydis (strain 521 / FGSC 9021)
Q7XT07 1.4e-22 101 31 6 239 2 Os04g0117600 tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like Oryza sativa subsp. japonica
Q1E2F4 1.42e-22 101 30 11 298 3 DUS3 tRNA-dihydrouridine(47) synthase [NAD(P)(+)] Coccidioides immitis (strain RS)
A5DBS1 1.72e-22 101 29 9 261 3 DUS3 tRNA-dihydrouridine(47) synthase [NAD(P)(+)] Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324)
Q96G46 3.3e-22 100 30 7 237 1 DUS3L tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like Homo sapiens
Q88LF2 6.1e-22 97 31 6 226 3 dusC tRNA-dihydrouridine(16) synthase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q91XI1 7.86e-22 99 30 7 237 1 Dus3l tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like Mus musculus
Q3KRC5 7.96e-22 99 30 7 236 2 Dus3l tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like Rattus norvegicus
Q5SMC7 9.86e-22 97 29 5 239 1 dus tRNA-dihydrouridine(20/20a) synthase Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
Q32M08 1.1e-21 96 28 11 319 2 Dus4l tRNA-dihydrouridine(20a/20b) synthase [NAD(P)+]-like Mus musculus
Q6BS64 1.73e-21 98 29 7 260 3 DUS3 tRNA-dihydrouridine(47) synthase [NAD(P)(+)] Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968)
Q5ALL3 2.81e-21 97 29 8 264 3 DUS3 tRNA-dihydrouridine(47) synthase [NAD(P)(+)] Candida albicans (strain SC5314 / ATCC MYA-2876)
Q8XYX1 3e-21 95 31 5 243 3 dusC tRNA-dihydrouridine(16) synthase Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q757E3 4.29e-21 97 28 11 312 3 DUS3 tRNA-dihydrouridine(47) synthase [NAD(P)(+)] Eremothecium gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056)
A2QAU6 6.94e-21 96 29 10 294 3 dus3 tRNA-dihydrouridine(47) synthase [NAD(P)(+)] Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513)
Q6FJ14 9.01e-21 96 30 10 270 3 DUS3 tRNA-dihydrouridine(47) synthase [NAD(P)(+)] Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138)
O68273 9.37e-21 94 29 7 287 3 dusC tRNA-dihydrouridine(16) synthase Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
A1D1U0 1.24e-20 95 30 12 297 3 dus3 tRNA-dihydrouridine(47) synthase [NAD(P)(+)] Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181)
Q0CZL3 1.48e-20 95 28 10 297 3 dus3 tRNA-dihydrouridine(47) synthase [NAD(P)(+)] Aspergillus terreus (strain NIH 2624 / FGSC A1156)
Q4WRX4 2e-20 95 29 12 297 3 dus3 tRNA-dihydrouridine(47) synthase [NAD(P)(+)] Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
Q2UL89 2.29e-20 95 30 11 298 3 dus3 tRNA-dihydrouridine(47) synthase [NAD(P)(+)] Aspergillus oryzae (strain ATCC 42149 / RIB 40)
A1CNY3 2.51e-20 95 29 11 297 3 dus3 tRNA-dihydrouridine(47) synthase [NAD(P)(+)] Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107)
P72872 2.79e-20 93 29 8 246 3 dus2 tRNA-dihydrouridine(20/20a) synthase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q6CWM0 6.75e-20 94 31 10 262 3 DUS3 tRNA-dihydrouridine(47) synthase [NAD(P)(+)] Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37)
A5DTS1 9.08e-20 93 29 9 270 3 DUS3 tRNA-dihydrouridine(47) synthase [NAD(P)(+)] Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239)
Q6P1R4 1.33e-19 92 30 5 230 1 DUS1L tRNA-dihydrouridine(16/17) synthase [NAD(P)(+)]-like Homo sapiens
Q5BF62 2.01e-19 92 29 12 297 3 dus3 tRNA-dihydrouridine(47) synthase [NAD(P)(+)] Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Q06053 3.83e-19 91 29 11 268 1 DUS3 tRNA-dihydrouridine(47) synthase [NAD(P)(+)] Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
A7A1S5 3.83e-19 91 29 11 268 3 DUS3 tRNA-dihydrouridine(47) synthase [NAD(P)(+)] Saccharomyces cerevisiae (strain YJM789)
Q9HGN6 5.57e-19 90 28 6 230 1 dus1 tRNA-dihydrouridine(16/17) synthase [NAD(P)(+)] Schizosaccharomyces pombe (strain 972 / ATCC 24843)
A6QYC6 1.03e-18 90 30 14 299 3 DUS3 tRNA-dihydrouridine(47) synthase [NAD(P)(+)] Ajellomyces capsulatus (strain NAm1 / WU24)
A7TQ73 1.59e-18 89 28 9 265 3 DUS3 tRNA-dihydrouridine(47) synthase [NAD(P)(+)] Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294 / BCRC 21397 / CBS 2163 / NBRC 10782 / NRRL Y-8283 / UCD 57-17)
Q8K582 1.68e-18 89 29 5 230 2 Dus1l tRNA-dihydrouridine(16/17) synthase [NAD(P)(+)]-like Rattus norvegicus
Q8C2P3 1.7e-18 89 29 5 230 2 Dus1l tRNA-dihydrouridine(16/17) synthase [NAD(P)(+)]-like Mus musculus
Q09504 2.4e-18 86 34 6 196 3 C45G9.2 Uncharacterized tRNA-dihydrouridine synthase-like protein C45G9.2 Caenorhabditis elegans
Q6C4K3 1.84e-17 86 27 5 260 3 DUS3 tRNA-dihydrouridine(47) synthase [NAD(P)(+)] Yarrowia lipolytica (strain CLIB 122 / E 150)
O74553 2.41e-17 84 27 2 222 1 dus4 tRNA-dihydrouridine(20a/20b) synthase [NAD(P)+] Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q9UTH9 3.03e-17 85 28 8 263 1 dus3 tRNA-dihydrouridine(47) synthase [NAD(P)(+)] Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q2HDP2 3.24e-17 85 29 13 299 3 DUS3 tRNA-dihydrouridine(47) synthase [NAD(P)(+)] Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970)
Q9I048 7.92e-17 83 25 9 262 3 dusA tRNA-dihydrouridine(20/20a) synthase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
A7EKL8 1.21e-16 84 29 12 292 3 dus3 tRNA-dihydrouridine(47) synthase [NAD(P)(+)] Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1)
A6RMI1 1.35e-16 84 28 11 292 3 dus3 tRNA-dihydrouridine(47) synthase [NAD(P)(+)] Botryotinia fuckeliana (strain B05.10)
Q9KUX9 2.04e-16 82 27 11 301 3 dusA tRNA-dihydrouridine(20/20a) synthase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A4RLF4 2.59e-16 83 27 11 305 3 DUS3 tRNA-dihydrouridine(47) synthase [NAD(P)(+)] Pyricularia oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)
Q8EAJ0 2.92e-16 81 27 8 241 3 dusA tRNA-dihydrouridine(20/20a) synthase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
P53759 4.14e-16 82 28 6 231 1 DUS1 tRNA-dihydrouridine(16/17) synthase [NAD(P)(+)] Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q87L85 5.63e-16 80 26 11 302 3 dusA tRNA-dihydrouridine(20/20a) synthase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q7SG01 6.52e-16 82 29 13 299 3 dus-3 tRNA-dihydrouridine(47) synthase [NAD(P)(+)] Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
Q06063 1.49e-15 79 30 6 229 1 DUS4 tRNA-dihydrouridine(20a/20b) synthase [NAD(P)+] Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q8P3X4 1.96e-15 79 29 5 245 3 dusA tRNA-dihydrouridine(20/20a) synthase Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q88KX0 3.29e-15 78 25 8 246 3 dusA tRNA-dihydrouridine(20/20a) synthase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q8CWK7 6.73e-15 77 26 9 245 3 dusA tRNA-dihydrouridine(20/20a) synthase Vibrio vulnificus (strain CMCP6)
Q8NYV4 1.6e-14 76 27 6 233 3 dus Probable tRNA-dihydrouridine synthase Staphylococcus aureus (strain MW2)
Q6GD38 1.6e-14 76 27 6 233 3 dus Probable tRNA-dihydrouridine synthase Staphylococcus aureus (strain MSSA476)
Q5HJT5 1.6e-14 76 27 6 233 3 dus Probable tRNA-dihydrouridine synthase Staphylococcus aureus (strain COL)
Q6GKK9 1.7e-14 76 27 6 233 3 dus Probable tRNA-dihydrouridine synthase Staphylococcus aureus (strain MRSA252)
Q8ZJ14 2.42e-14 76 28 10 251 3 dusA tRNA-dihydrouridine(20/20a) synthase Yersinia pestis
P67717 2.51e-14 75 27 6 233 1 dus Probable tRNA-dihydrouridine synthase Staphylococcus aureus (strain N315)
P67716 2.51e-14 75 27 6 233 3 dus Probable tRNA-dihydrouridine synthase Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HKD5 4.86e-14 75 27 7 233 3 dus Probable tRNA-dihydrouridine synthase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
O31546 7.61e-14 74 26 7 235 3 dus2 Probable tRNA-dihydrouridine synthase 2 Bacillus subtilis (strain 168)
Q7VNV2 8.31e-14 74 25 14 305 3 dusA tRNA-dihydrouridine(20/20a) synthase Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q8CU07 2.2e-13 73 27 7 233 3 dus Probable tRNA-dihydrouridine synthase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q8PFF8 6.11e-13 72 28 6 250 3 dusA tRNA-dihydrouridine(20/20a) synthase Xanthomonas axonopodis pv. citri (strain 306)
Q0U9D6 8.14e-13 72 25 10 294 3 DUS3 tRNA-dihydrouridine(47) synthase [NAD(P)(+)] Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173)
P44794 8.17e-13 71 24 9 303 3 dusA tRNA-dihydrouridine(20/20a) synthase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q9CL29 1.15e-12 71 25 12 303 3 dusA tRNA-dihydrouridine(20/20a) synthase Pasteurella multocida (strain Pm70)
P32695 1.91e-12 70 27 10 252 1 dusA tRNA-dihydrouridine(20/20a) synthase Escherichia coli (strain K12)
Q8X5V6 1.91e-12 70 27 10 252 3 dusA tRNA-dihydrouridine(20/20a) synthase Escherichia coli O157:H7
Q7UBC5 2.27e-12 70 28 10 252 3 dusA tRNA-dihydrouridine(20/20a) synthase Shigella flexneri
Q8FB30 2.65e-12 70 27 10 252 3 dusA tRNA-dihydrouridine(20/20a) synthase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q884G7 3.39e-12 69 24 8 249 3 dusA tRNA-dihydrouridine(20/20a) synthase Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q8Z1T1 2.31e-11 67 26 9 239 3 dusA tRNA-dihydrouridine(20/20a) synthase Salmonella typhi
Q8ZKH4 4.15e-11 66 26 9 239 3 dusA tRNA-dihydrouridine(20/20a) synthase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
O74731 8.27e-11 66 23 10 346 1 dus2 tRNA-dihydrouridine(20) synthase [NAD(P)+] Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q9PGB5 1.39e-10 65 27 8 243 3 dusA tRNA-dihydrouridine(20/20a) synthase Xylella fastidiosa (strain 9a5c)
Q87AY2 5.71e-10 63 27 8 243 3 dusA tRNA-dihydrouridine(20/20a) synthase Xylella fastidiosa (strain Temecula1 / ATCC 700964)
O27281 2.41e-07 55 28 9 221 3 pyrD Dihydroorotate dehydrogenase B (NAD(+)), catalytic subunit Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
Q8CWG1 1.67e-05 49 25 9 250 3 pyrD Dihydroorotate dehydrogenase B (NAD(+)), catalytic subunit Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q8TT55 2.15e-05 49 25 10 278 3 pyrD Dihydroorotate dehydrogenase B (NAD(+)), catalytic subunit Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
A8FD19 2.36e-05 48 25 11 283 3 pyrD Dihydroorotate dehydrogenase B (NAD(+)), catalytic subunit Bacillus pumilus (strain SAFR-032)
P53720 6.88e-05 47 30 7 163 1 SMM1 tRNA-dihydrouridine(20) synthase [NAD(P)+] Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q8PW56 7.34e-05 47 23 9 285 3 pyrD Dihydroorotate dehydrogenase B (NAD(+)), catalytic subunit Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q5FJB5 7.92e-05 47 24 10 255 3 pyrD Dihydroorotate dehydrogenase A (fumarate) Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
A8YVZ9 0.000126 46 25 13 258 3 pyrD Dihydroorotate dehydrogenase A (fumarate) Lactobacillus helveticus (strain DPC 4571)
Q1G864 0.000249 45 26 13 258 3 pyrD Dihydroorotate dehydrogenase A (fumarate) Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / BCRC 10696 / JCM 1002 / NBRC 13953 / NCIMB 11778 / NCTC 12712 / WDCM 00102 / Lb 14)
Q047M3 0.000326 45 26 13 258 3 pyrD Dihydroorotate dehydrogenase A (fumarate) Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365 / Lb-18)
Q038Z3 0.000666 44 27 7 188 3 pyrD Dihydroorotate dehydrogenase A (fumarate) Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
Q3B287 0.001 43 28 7 156 3 hisA 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS11555
Feature type CDS
Gene dusB
Product tRNA dihydrouridine synthase DusB
Location 460873 - 461844 (strand: -1)
Length 972 (nucleotides) / 323 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000002
Length 573139 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_827
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01207 Dihydrouridine synthase (Dus)

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0042 Translation, ribosomal structure and biogenesis (J) J tRNA-dihydrouridine synthase

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K05540 tRNA-dihydrouridine synthase B [EC:1.-.-.-] - -

Protein Sequence

MRIGQYQLKNRLIAAPMAGITDRPFRSLCYEMGAGMAVSEMLSSNPQVWKTDKSRLRMVHRDEPGIRSVQIAGNDPAEMAAAAKINVAGGAQIIDINMGCPAKKVNRKLAGSALLRYPHLVEEILSAVVNAVDVPVTLKIRTGWSPEERNCVMIAQLAERCGIQAITIHGRTRACLFNGEAEYDNIRTVKQTVAIPVIANGDITDPLKAGAVLDYTGADALMIGRAAQGRPWIFREIQHYLDTGELLPPLPGAEVQRIMCEHVRELHDFYGQGKGARIARKHVSWYMQEHAPDVQFRRSFNAIEDAGEQLEALEAYFENFLRK

Flanking regions ( +/- flanking 50bp)

GCGTAATATACGCGCCCTTGCAGTCACAGTATGGCCACACTTCTTCGTCTATGCGAATCGGACAATACCAGTTGAAAAACCGCCTTATAGCGGCCCCTATGGCAGGCATTACAGATCGGCCTTTCCGGTCTTTGTGTTATGAAATGGGCGCAGGTATGGCCGTCTCAGAGATGCTCTCTTCCAATCCTCAGGTATGGAAGACGGACAAATCGAGATTACGCATGGTACATCGTGATGAGCCGGGTATTCGTTCTGTGCAGATAGCTGGTAATGATCCCGCTGAAATGGCGGCCGCGGCAAAGATTAATGTTGCCGGCGGTGCGCAAATCATCGATATCAATATGGGTTGTCCCGCCAAAAAAGTGAATCGCAAGCTGGCAGGCTCAGCACTGCTGCGTTATCCGCATCTGGTAGAAGAGATTCTCTCAGCAGTGGTAAATGCAGTCGACGTGCCTGTGACGCTGAAGATTCGCACCGGTTGGTCACCGGAAGAACGAAACTGTGTAATGATTGCCCAATTGGCCGAGCGTTGCGGTATTCAGGCTATTACAATTCATGGCAGGACCCGTGCCTGTCTTTTTAATGGTGAAGCCGAATACGACAACATCCGGACAGTTAAGCAGACTGTTGCCATACCGGTTATTGCCAATGGCGACATAACTGACCCGCTTAAAGCCGGGGCAGTACTGGACTACACCGGCGCAGACGCGCTGATGATCGGTCGTGCTGCTCAGGGAAGACCCTGGATCTTCCGGGAAATCCAGCACTATCTGGACACAGGTGAACTGTTGCCACCGCTGCCCGGTGCAGAGGTGCAACGCATTATGTGTGAGCATGTACGGGAATTGCATGACTTTTATGGTCAAGGCAAGGGAGCCCGTATAGCCCGCAAGCATGTTTCCTGGTATATGCAGGAACATGCGCCTGATGTTCAGTTTCGGCGCTCATTCAACGCCATTGAGGATGCCGGCGAACAGCTGGAGGCGTTGGAAGCATATTTTGAAAATTTTTTGCGTAAATAAAGAAAAGAGCTGACAGAACTATGTTCGAACAACGCGTAAATTCTGACGTA