Homologs in group_781

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_03615 FBDBKF_03615 70.9 Morganella morganii S1 frdD fumarate reductase subunit FrdD
EHELCC_06920 EHELCC_06920 70.9 Morganella morganii S2 frdD fumarate reductase subunit FrdD
NLDBIP_07245 NLDBIP_07245 70.9 Morganella morganii S4 frdD fumarate reductase subunit FrdD
LHKJJB_06780 LHKJJB_06780 70.9 Morganella morganii S3 frdD fumarate reductase subunit FrdD
HKOGLL_04150 HKOGLL_04150 70.9 Morganella morganii S5 frdD fumarate reductase subunit FrdD
F4V73_RS11255 F4V73_RS11255 68.4 Morganella psychrotolerans frdD fumarate reductase subunit FrdD

Distribution of the homologs in the orthogroup group_781

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_781

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P20924 5.98e-82 238 100 0 119 3 frdD Fumarate reductase subunit D Proteus vulgaris
B4EWY4 5.98e-82 238 100 0 119 3 frdD Fumarate reductase subunit D Proteus mirabilis (strain HI4320)
A8G8T4 1.14e-58 179 70 1 117 3 frdD Fumarate reductase subunit D Serratia proteamaculans (strain 568)
C5BDL4 2.65e-58 178 66 0 119 3 frdD Fumarate reductase subunit D Edwardsiella ictaluri (strain 93-146)
A7MMB3 5.28e-58 177 67 1 117 3 frdD Fumarate reductase subunit D Cronobacter sakazakii (strain ATCC BAA-894)
Q8ZIX8 7.42e-58 177 70 1 117 3 frdD Fumarate reductase subunit D Yersinia pestis
P0A8Q5 8.28e-56 172 64 1 117 3 frdD Fumarate reductase subunit D Shigella flexneri
Q0SXC5 8.28e-56 172 64 1 117 3 frdD Fumarate reductase subunit D Shigella flexneri serotype 5b (strain 8401)
Q328H3 8.28e-56 172 64 1 117 3 frdD Fumarate reductase subunit D Shigella dysenteriae serotype 1 (strain Sd197)
B7LLT5 8.28e-56 172 64 1 117 3 frdD Fumarate reductase subunit D Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q1R3A6 8.28e-56 172 64 1 117 3 frdD Fumarate reductase subunit D Escherichia coli (strain UTI89 / UPEC)
B1LQH4 8.28e-56 172 64 1 117 3 frdD Fumarate reductase subunit D Escherichia coli (strain SMS-3-5 / SECEC)
B7NG90 8.28e-56 172 64 1 117 3 frdD Fumarate reductase subunit D Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A8Q3 8.28e-56 172 64 1 117 1 frdD Fumarate reductase subunit D Escherichia coli (strain K12)
B1ITP5 8.28e-56 172 64 1 117 3 frdD Fumarate reductase subunit D Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
Q0T9N8 8.28e-56 172 64 1 117 3 frdD Fumarate reductase subunit D Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AJ59 8.28e-56 172 64 1 117 3 frdD Fumarate reductase subunit D Escherichia coli O1:K1 / APEC
B1XDQ6 8.28e-56 172 64 1 117 3 frdD Fumarate reductase subunit D Escherichia coli (strain K12 / DH10B)
C5A1E5 8.28e-56 172 64 1 117 3 frdD Fumarate reductase subunit D Escherichia coli (strain K12 / MC4100 / BW2952)
B7MSH3 8.28e-56 172 64 1 117 3 frdD Fumarate reductase subunit D Escherichia coli O81 (strain ED1a)
B7NTL2 8.28e-56 172 64 1 117 3 frdD Fumarate reductase subunit D Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5Z2G2 8.28e-56 172 64 1 117 3 frdD Fumarate reductase subunit D Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A8Q4 8.28e-56 172 64 1 117 3 frdD Fumarate reductase subunit D Escherichia coli O157:H7
B7MKV8 8.28e-56 172 64 1 117 3 frdD Fumarate reductase subunit D Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UPX3 8.28e-56 172 64 1 117 3 frdD Fumarate reductase subunit D Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Q8FAL7 1.31e-55 171 64 1 117 3 frdD Fumarate reductase subunit D Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q3YUI7 1.76e-55 171 63 1 117 3 frdD Fumarate reductase subunit D Shigella sonnei (strain Ss046)
Q31T86 1.76e-55 171 63 1 117 3 frdD Fumarate reductase subunit D Shigella boydii serotype 4 (strain Sb227)
B6I260 1.76e-55 171 63 1 117 3 frdD Fumarate reductase subunit D Escherichia coli (strain SE11)
A8A7Q0 1.76e-55 171 63 1 117 3 frdD Fumarate reductase subunit D Escherichia coli O9:H4 (strain HS)
B7M8R6 1.76e-55 171 63 1 117 3 frdD Fumarate reductase subunit D Escherichia coli O8 (strain IAI1)
B7LC12 1.76e-55 171 63 1 117 3 frdD Fumarate reductase subunit D Escherichia coli (strain 55989 / EAEC)
A7ZV24 1.76e-55 171 63 1 117 3 frdD Fumarate reductase subunit D Escherichia coli O139:H28 (strain E24377A / ETEC)
A6TH70 3.84e-55 170 65 1 114 3 frdD Fumarate reductase subunit D Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5Y349 3.84e-55 170 65 1 114 3 frdD Fumarate reductase subunit D Klebsiella pneumoniae (strain 342)
B2TY29 1.74e-54 169 62 1 117 3 frdD Fumarate reductase subunit D Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B5BKG4 5.45e-54 167 61 1 117 3 frdD Fumarate reductase subunit D Salmonella paratyphi A (strain AKU_12601)
Q5PL71 5.45e-54 167 61 1 117 3 frdD Fumarate reductase subunit D Salmonella paratyphi A (strain ATCC 9150 / SARB42)
P67645 7.17e-54 167 61 1 117 3 frdD Fumarate reductase subunit D Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P67646 7.17e-54 167 61 1 117 3 frdD Fumarate reductase subunit D Salmonella typhi
B4TSD5 7.17e-54 167 61 1 117 3 frdD Fumarate reductase subunit D Salmonella schwarzengrund (strain CVM19633)
C0Q6B2 7.17e-54 167 61 1 117 3 frdD Fumarate reductase subunit D Salmonella paratyphi C (strain RKS4594)
A9N409 7.17e-54 167 61 1 117 3 frdD Fumarate reductase subunit D Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B4T2P9 7.17e-54 167 61 1 117 3 frdD Fumarate reductase subunit D Salmonella newport (strain SL254)
B4TF88 7.17e-54 167 61 1 117 3 frdD Fumarate reductase subunit D Salmonella heidelberg (strain SL476)
B5R9A1 7.17e-54 167 61 1 117 3 frdD Fumarate reductase subunit D Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R015 7.17e-54 167 61 1 117 3 frdD Fumarate reductase subunit D Salmonella enteritidis PT4 (strain P125109)
B5FRL0 7.17e-54 167 61 1 117 3 frdD Fumarate reductase subunit D Salmonella dublin (strain CT_02021853)
A9MFR0 7.17e-54 167 61 1 117 3 frdD Fumarate reductase subunit D Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B5F2L8 7.17e-54 167 61 1 117 3 frdD Fumarate reductase subunit D Salmonella agona (strain SL483)
C6DFN7 1.39e-53 166 70 0 105 3 frdD Fumarate reductase subunit D Pectobacterium carotovorum subsp. carotovorum (strain PC1)
A8AMP5 1.86e-53 166 60 1 117 3 frdD Fumarate reductase subunit D Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q6D029 3.3e-53 165 69 0 105 3 frdD Fumarate reductase subunit D Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q57GN7 4.99e-53 165 60 1 117 3 frdD Fumarate reductase subunit D Salmonella choleraesuis (strain SC-B67)
A4W5P8 9.51e-51 159 59 1 117 3 frdD Fumarate reductase subunit D Enterobacter sp. (strain 638)
Q8DCX4 6.07e-35 119 45 2 120 3 frdD Fumarate reductase subunit D Vibrio vulnificus (strain CMCP6)
Q7MGX4 1.03e-34 119 45 2 120 3 frdD Fumarate reductase subunit D Vibrio vulnificus (strain YJ016)
Q87KY1 1.24e-32 114 47 2 116 3 frdD Fumarate reductase subunit D Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
C3LS88 1.48e-32 114 46 2 116 3 frdD Fumarate reductase subunit D Vibrio cholerae serotype O1 (strain M66-2)
Q9KNS2 1.48e-32 114 46 2 116 3 frdD Fumarate reductase subunit D Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A7MZ44 1.88e-32 113 45 2 116 3 frdD Fumarate reductase subunit D Vibrio campbellii (strain ATCC BAA-1116)
B6EMS1 2.38e-32 113 46 2 116 3 frdD Fumarate reductase subunit D Aliivibrio salmonicida (strain LFI1238)
Q6LM12 3.64e-32 112 46 2 116 3 frdD Fumarate reductase subunit D Photobacterium profundum (strain SS9)
A1REF8 1.3e-30 108 45 2 118 3 frdD Fumarate reductase subunit D Shewanella sp. (strain W3-18-1)
A4Y2A0 1.3e-30 108 45 2 118 3 frdD Fumarate reductase subunit D Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
A5UHY2 1.72e-30 108 44 1 116 3 frdD Fumarate reductase subunit D Haemophilus influenzae (strain PittGG)
Q4QM68 2.01e-30 107 44 1 116 3 frdD Fumarate reductase subunit D Haemophilus influenzae (strain 86-028NP)
A5UDP2 2.27e-30 107 44 1 116 3 frdD Fumarate reductase subunit D Haemophilus influenzae (strain PittEE)
P44891 2.55e-30 107 44 1 116 3 frdD Fumarate reductase subunit D Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
B5FBS8 5.18e-30 107 51 1 92 3 frdD Fumarate reductase subunit D Aliivibrio fischeri (strain MJ11)
Q65RZ8 5.47e-25 94 45 1 116 3 frdD Fumarate reductase subunit D Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q9CP59 9.64e-25 93 42 2 118 3 frdD Fumarate reductase subunit D Pasteurella multocida (strain Pm70)
A6VQC0 1.99e-23 90 46 1 116 3 frdD Fumarate reductase subunit D Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
P59844 2.29e-23 90 42 2 119 3 frdD Fumarate reductase subunit D Haemophilus ducreyi (strain 35000HP / ATCC 700724)
B0BRC0 4.52e-22 86 40 2 119 3 frdD Fumarate reductase subunit D Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B3GYK8 4.52e-22 86 40 2 119 3 frdD Fumarate reductase subunit D Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3N2H4 4.52e-22 86 40 2 119 3 frdD Fumarate reductase subunit D Actinobacillus pleuropneumoniae serotype 5b (strain L20)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS17835
Feature type CDS
Gene frdD
Product fumarate reductase subunit FrdD
Location 3917000 - 3917359 (strand: -1)
Length 360 (nucleotides) / 119 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_781
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF02313 Fumarate reductase subunit D

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3080 Energy production and conversion (C) C Fumarate reductase subunit D

Kegg Ortholog Annotation(s)

Protein Sequence

MNQNQLPKRSDEPIFWGLFGAGGMWSAIVSPAIIILLGILIPMGIAPEAFTYDRIMAFSQGFIGRIFLLLMIILPVWCALHRIHHTLHDFKVHVPASNWVFYGAAAIISVIAIIGVFTL

Flanking regions ( +/- flanking 50bp)

ACTGTCGTTATTCTGGCAGTGGCGCTAATTGTTTAACCCAGGAGGAAATAATGAATCAGAATCAACTTCCTAAGCGCTCTGATGAACCTATTTTCTGGGGATTATTTGGTGCAGGTGGTATGTGGAGTGCGATTGTCTCTCCAGCAATTATTATCCTGCTCGGTATTCTAATCCCGATGGGTATTGCGCCAGAAGCATTTACTTACGATCGTATCATGGCATTTAGCCAAGGTTTTATTGGTCGTATTTTCTTACTGCTAATGATTATTCTGCCAGTTTGGTGTGCATTACACCGTATTCACCATACGTTGCACGATTTTAAAGTGCATGTACCTGCTAGTAATTGGGTATTTTATGGTGCTGCAGCAATTATTAGTGTTATCGCAATTATTGGTGTTTTTACACTATAATCGCTTGATAAATAAAATTAAAGCCACTCATTGAGTGGCTTTTTTTATCG