Homologs in group_781

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_06920 EHELCC_06920 100.0 Morganella morganii S2 frdD fumarate reductase subunit FrdD
NLDBIP_07245 NLDBIP_07245 100.0 Morganella morganii S4 frdD fumarate reductase subunit FrdD
LHKJJB_06780 LHKJJB_06780 100.0 Morganella morganii S3 frdD fumarate reductase subunit FrdD
HKOGLL_04150 HKOGLL_04150 100.0 Morganella morganii S5 frdD fumarate reductase subunit FrdD
F4V73_RS11255 F4V73_RS11255 86.4 Morganella psychrotolerans frdD fumarate reductase subunit FrdD
PMI_RS17835 PMI_RS17835 70.9 Proteus mirabilis HI4320 frdD fumarate reductase subunit FrdD

Distribution of the homologs in the orthogroup group_781

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_781

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0A8Q5 2.62e-59 181 70 1 119 3 frdD Fumarate reductase subunit D Shigella flexneri
Q0SXC5 2.62e-59 181 70 1 119 3 frdD Fumarate reductase subunit D Shigella flexneri serotype 5b (strain 8401)
Q328H3 2.62e-59 181 70 1 119 3 frdD Fumarate reductase subunit D Shigella dysenteriae serotype 1 (strain Sd197)
B7LLT5 2.62e-59 181 70 1 119 3 frdD Fumarate reductase subunit D Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q1R3A6 2.62e-59 181 70 1 119 3 frdD Fumarate reductase subunit D Escherichia coli (strain UTI89 / UPEC)
B1LQH4 2.62e-59 181 70 1 119 3 frdD Fumarate reductase subunit D Escherichia coli (strain SMS-3-5 / SECEC)
B7NG90 2.62e-59 181 70 1 119 3 frdD Fumarate reductase subunit D Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A8Q3 2.62e-59 181 70 1 119 1 frdD Fumarate reductase subunit D Escherichia coli (strain K12)
B1ITP5 2.62e-59 181 70 1 119 3 frdD Fumarate reductase subunit D Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
Q0T9N8 2.62e-59 181 70 1 119 3 frdD Fumarate reductase subunit D Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AJ59 2.62e-59 181 70 1 119 3 frdD Fumarate reductase subunit D Escherichia coli O1:K1 / APEC
B1XDQ6 2.62e-59 181 70 1 119 3 frdD Fumarate reductase subunit D Escherichia coli (strain K12 / DH10B)
C5A1E5 2.62e-59 181 70 1 119 3 frdD Fumarate reductase subunit D Escherichia coli (strain K12 / MC4100 / BW2952)
B7MSH3 2.62e-59 181 70 1 119 3 frdD Fumarate reductase subunit D Escherichia coli O81 (strain ED1a)
B7NTL2 2.62e-59 181 70 1 119 3 frdD Fumarate reductase subunit D Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5Z2G2 2.62e-59 181 70 1 119 3 frdD Fumarate reductase subunit D Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A8Q4 2.62e-59 181 70 1 119 3 frdD Fumarate reductase subunit D Escherichia coli O157:H7
B7MKV8 2.62e-59 181 70 1 119 3 frdD Fumarate reductase subunit D Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UPX3 2.62e-59 181 70 1 119 3 frdD Fumarate reductase subunit D Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Q8FAL7 3.16e-59 181 70 1 119 3 frdD Fumarate reductase subunit D Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A8G8T4 3.77e-59 180 73 1 119 3 frdD Fumarate reductase subunit D Serratia proteamaculans (strain 568)
Q3YUI7 3.98e-59 180 69 1 119 3 frdD Fumarate reductase subunit D Shigella sonnei (strain Ss046)
Q31T86 3.98e-59 180 69 1 119 3 frdD Fumarate reductase subunit D Shigella boydii serotype 4 (strain Sb227)
B6I260 3.98e-59 180 69 1 119 3 frdD Fumarate reductase subunit D Escherichia coli (strain SE11)
A8A7Q0 3.98e-59 180 69 1 119 3 frdD Fumarate reductase subunit D Escherichia coli O9:H4 (strain HS)
B7M8R6 3.98e-59 180 69 1 119 3 frdD Fumarate reductase subunit D Escherichia coli O8 (strain IAI1)
B7LC12 3.98e-59 180 69 1 119 3 frdD Fumarate reductase subunit D Escherichia coli (strain 55989 / EAEC)
A7ZV24 3.98e-59 180 69 1 119 3 frdD Fumarate reductase subunit D Escherichia coli O139:H28 (strain E24377A / ETEC)
Q8ZIX8 2.9e-58 178 72 1 118 3 frdD Fumarate reductase subunit D Yersinia pestis
A8AMP5 3e-58 178 68 1 119 3 frdD Fumarate reductase subunit D Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
B2TY29 4.3e-58 178 68 1 119 3 frdD Fumarate reductase subunit D Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
A6TH70 4.64e-58 177 70 1 117 3 frdD Fumarate reductase subunit D Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5Y349 4.64e-58 177 70 1 117 3 frdD Fumarate reductase subunit D Klebsiella pneumoniae (strain 342)
Q57GN7 6.97e-58 177 68 1 119 3 frdD Fumarate reductase subunit D Salmonella choleraesuis (strain SC-B67)
B5BKG4 8.4e-58 177 68 1 119 3 frdD Fumarate reductase subunit D Salmonella paratyphi A (strain AKU_12601)
Q5PL71 8.4e-58 177 68 1 119 3 frdD Fumarate reductase subunit D Salmonella paratyphi A (strain ATCC 9150 / SARB42)
P67645 1e-57 177 68 1 119 3 frdD Fumarate reductase subunit D Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P67646 1e-57 177 68 1 119 3 frdD Fumarate reductase subunit D Salmonella typhi
B4TSD5 1e-57 177 68 1 119 3 frdD Fumarate reductase subunit D Salmonella schwarzengrund (strain CVM19633)
C0Q6B2 1e-57 177 68 1 119 3 frdD Fumarate reductase subunit D Salmonella paratyphi C (strain RKS4594)
A9N409 1e-57 177 68 1 119 3 frdD Fumarate reductase subunit D Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B4T2P9 1e-57 177 68 1 119 3 frdD Fumarate reductase subunit D Salmonella newport (strain SL254)
B4TF88 1e-57 177 68 1 119 3 frdD Fumarate reductase subunit D Salmonella heidelberg (strain SL476)
B5R9A1 1e-57 177 68 1 119 3 frdD Fumarate reductase subunit D Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R015 1e-57 177 68 1 119 3 frdD Fumarate reductase subunit D Salmonella enteritidis PT4 (strain P125109)
B5FRL0 1e-57 177 68 1 119 3 frdD Fumarate reductase subunit D Salmonella dublin (strain CT_02021853)
A9MFR0 1e-57 177 68 1 119 3 frdD Fumarate reductase subunit D Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B5F2L8 1e-57 177 68 1 119 3 frdD Fumarate reductase subunit D Salmonella agona (strain SL483)
A4W5P8 4.8e-56 172 66 1 119 3 frdD Fumarate reductase subunit D Enterobacter sp. (strain 638)
A7MMB3 3.34e-55 171 66 1 119 3 frdD Fumarate reductase subunit D Cronobacter sakazakii (strain ATCC BAA-894)
Q6D029 2.49e-53 166 71 0 107 3 frdD Fumarate reductase subunit D Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
C6DFN7 4.17e-53 165 70 0 107 3 frdD Fumarate reductase subunit D Pectobacterium carotovorum subsp. carotovorum (strain PC1)
C5BDL4 1.03e-51 162 66 0 118 3 frdD Fumarate reductase subunit D Edwardsiella ictaluri (strain 93-146)
P20924 3.02e-49 155 70 0 116 3 frdD Fumarate reductase subunit D Proteus vulgaris
B4EWY4 3.02e-49 155 70 0 116 3 frdD Fumarate reductase subunit D Proteus mirabilis (strain HI4320)
A5UHY2 4.61e-35 119 50 1 118 3 frdD Fumarate reductase subunit D Haemophilus influenzae (strain PittGG)
P44891 5.25e-35 119 50 1 118 3 frdD Fumarate reductase subunit D Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UDP2 6.54e-35 119 50 1 118 3 frdD Fumarate reductase subunit D Haemophilus influenzae (strain PittEE)
Q4QM68 7.3e-35 119 50 1 118 3 frdD Fumarate reductase subunit D Haemophilus influenzae (strain 86-028NP)
C3LS88 2.25e-33 115 48 2 115 3 frdD Fumarate reductase subunit D Vibrio cholerae serotype O1 (strain M66-2)
Q9KNS2 2.25e-33 115 48 2 115 3 frdD Fumarate reductase subunit D Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q6LM12 2.01e-32 113 46 2 115 3 frdD Fumarate reductase subunit D Photobacterium profundum (strain SS9)
B6EMS1 3.47e-32 112 46 2 115 3 frdD Fumarate reductase subunit D Aliivibrio salmonicida (strain LFI1238)
Q87KY1 1.77e-30 108 44 2 114 3 frdD Fumarate reductase subunit D Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
B5FBS8 2.13e-30 108 46 2 115 3 frdD Fumarate reductase subunit D Aliivibrio fischeri (strain MJ11)
A7MZ44 5.7e-30 107 43 2 114 3 frdD Fumarate reductase subunit D Vibrio campbellii (strain ATCC BAA-1116)
Q7MGX4 6.57e-30 107 43 2 114 3 frdD Fumarate reductase subunit D Vibrio vulnificus (strain YJ016)
Q8DCX4 8.53e-30 106 43 2 114 3 frdD Fumarate reductase subunit D Vibrio vulnificus (strain CMCP6)
A1REF8 9.68e-30 106 44 3 122 3 frdD Fumarate reductase subunit D Shewanella sp. (strain W3-18-1)
A4Y2A0 9.68e-30 106 44 3 122 3 frdD Fumarate reductase subunit D Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
Q65RZ8 1.31e-27 100 44 1 118 3 frdD Fumarate reductase subunit D Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
A6VQC0 2.52e-27 100 47 2 119 3 frdD Fumarate reductase subunit D Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
Q9CP59 1.49e-24 93 43 1 117 3 frdD Fumarate reductase subunit D Pasteurella multocida (strain Pm70)
P59844 1.26e-23 90 42 1 118 3 frdD Fumarate reductase subunit D Haemophilus ducreyi (strain 35000HP / ATCC 700724)
B0BRC0 2.94e-23 89 41 1 118 3 frdD Fumarate reductase subunit D Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B3GYK8 2.94e-23 89 41 1 118 3 frdD Fumarate reductase subunit D Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3N2H4 2.94e-23 89 41 1 118 3 frdD Fumarate reductase subunit D Actinobacillus pleuropneumoniae serotype 5b (strain L20)

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_03615
Feature type CDS
Gene frdD
Product fumarate reductase subunit FrdD
Location 128651 - 129007 (strand: 1)
Length 357 (nucleotides) / 118 (amino acids)

Contig

Accession contig_3
Length 210665 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_781
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF02313 Fumarate reductase subunit D

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3080 Energy production and conversion (C) C Fumarate reductase subunit D

Kegg Ortholog Annotation(s)

Protein Sequence

MINPNPKRSQEPVFWGLFGAGGMWSAIVSPAVIVLLAFLVPFAVAPDMLSYSRILAFCQGFIGKAFLLLMIILPLWCALHRIHHCMHDLKIHVPAGRWVFYGLATILSVMAVIGVITL

Flanking regions ( +/- flanking 50bp)

AACGCCGTCATTCTGGCCGTTGCGTTACTGTGATAAGGAAGGAAACTGATATGATTAATCCGAATCCGAAACGCTCACAGGAACCGGTTTTCTGGGGATTGTTTGGCGCAGGCGGCATGTGGAGTGCCATTGTTTCACCGGCCGTTATTGTGCTGCTGGCTTTTCTGGTCCCGTTTGCTGTGGCACCGGATATGCTCAGTTACAGCCGTATCCTGGCTTTCTGCCAGGGCTTTATCGGCAAAGCGTTCCTGCTGCTGATGATTATCCTGCCGCTGTGGTGTGCGCTTCACCGTATCCACCACTGTATGCATGACCTGAAAATTCATGTACCTGCGGGACGCTGGGTCTTTTACGGCCTGGCAACCATCCTCAGTGTGATGGCCGTGATTGGTGTCATCACGCTGTAATCATTGTCTGTCATAAAAAGACCGGCGCTTAAACGCCGGTCTTTTTTTAT