Homologs in group_2225

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_17015 FBDBKF_17015 69.1 Morganella morganii S1 ilvN acetolactate synthase small subunit
EHELCC_16575 EHELCC_16575 69.1 Morganella morganii S2 ilvN acetolactate synthase small subunit
NLDBIP_16785 NLDBIP_16785 69.1 Morganella morganii S4 ilvN acetolactate synthase small subunit
LHKJJB_16685 LHKJJB_16685 69.1 Morganella morganii S3 ilvN acetolactate synthase small subunit
HKOGLL_17650 HKOGLL_17650 69.1 Morganella morganii S5 ilvN acetolactate synthase small subunit
F4V73_RS18475 F4V73_RS18475 69.1 Morganella psychrotolerans ilvN acetolactate synthase small subunit

Distribution of the homologs in the orthogroup group_2225

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2225

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0ADF8 2.15e-35 119 63 1 87 1 ilvN Acetolactate synthase isozyme 1 small subunit Escherichia coli (strain K12)
P0ADF9 2.15e-35 119 63 1 87 3 ilvN Acetolactate synthase isozyme 1 small subunit Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0ADG0 2.15e-35 119 63 1 87 3 ilvN Acetolactate synthase isozyme 1 small subunit Escherichia coli O157:H7
Q9MS98 2.47e-09 54 31 1 76 3 ilvH Acetolactate synthase small subunit Galdieria sulphuraria
O78451 2.81e-09 54 38 1 70 3 ilvH Acetolactate synthase small subunit Guillardia theta
Q9TLY1 7.7e-09 53 37 1 70 3 ilvH Acetolactate synthase small subunit Cyanidium caldarium
Q57625 1.09e-08 52 37 1 69 3 ilvH Probable acetolactate synthase small subunit Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q55141 1.27e-08 52 38 1 71 3 ilvH Acetolactate synthase small subunit Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q1XDQ7 2.13e-08 52 36 1 71 3 ilvH Acetolactate synthase small subunit Neopyropia yezoensis
P51230 2.23e-08 52 36 1 71 3 ilvH Acetolactate synthase small subunit Porphyra purpurea
O28555 6.81e-08 50 32 1 64 3 ilvH Probable acetolactate synthase small subunit Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
O27492 3.04e-07 48 32 1 70 3 ilvH Probable acetolactate synthase small subunit Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
P9WKJ3 5.74e-07 48 32 1 74 1 ilvH Putative acetolactate synthase small subunit Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WKJ2 5.74e-07 48 32 1 74 3 ilvH Putative acetolactate synthase small subunit Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P65162 5.74e-07 48 32 1 74 3 ilvH Acetolactate synthase small subunit Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q9FFF4 2.88e-06 47 34 1 70 1 AHASS2 Acetolactate synthase small subunit 2, chloroplastic Arabidopsis thaliana
Q9SMC2 3.35e-06 46 35 1 71 2 None Acetolactate synthase small subunit 1, chloroplastic Nicotiana plumbaginifolia
Q59499 5.73e-06 45 33 2 75 3 ilvH Acetolactate synthase small subunit Mycobacterium avium
A0QUX7 8.84e-06 44 30 2 83 1 ilvH Acetolactate synthase small subunit Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q93YZ7 1.36e-05 45 36 1 69 1 AHASS1 Acetolactate synthase small subunit 1, chloroplastic Arabidopsis thaliana
Q89AP8 3.25e-05 43 26 1 80 3 ilvH Acetolactate synthase small subunit Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
P21622 5.32e-05 42 27 1 66 3 ilvH Acetolactate synthase isozyme 3 small subunit Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P00894 5.55e-05 42 27 1 66 1 ilvH Acetolactate synthase isozyme 3 small subunit Escherichia coli (strain K12)
P45260 6.74e-05 42 31 1 69 3 ilvH Acetolactate synthase small subunit Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
O33113 7.49e-05 42 31 1 69 3 ilvH Acetolactate synthase small subunit Mycobacterium leprae (strain TN)
P25605 0.000227 41 33 1 69 1 ILV6 Acetolactate synthase small subunit, mitochondrial Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
O60086 0.000791 40 30 1 63 1 SPBC14C8.04 Probable acetolactate synthase small subunit Schizosaccharomyces pombe (strain 972 / ATCC 24843)
P57320 0.001 39 25 1 66 3 ilvH Acetolactate synthase small subunit Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS17495
Feature type CDS
Gene ilvN
Product acetolactate synthase small subunit
Location 3840428 - 3840712 (strand: 1)
Length 285 (nucleotides) / 94 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_2225
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF22629 AHAS-like ACT domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0440 Amino acid transport and metabolism (E) E Acetolactate synthase, small subunit

Kegg Ortholog Annotation(s)

Protein Sequence

MSLQSQPIALELIVRNHPGVMTHICGLFARRAFNVDGILCLPMKNSDKSRIWLLVQKDERLMQMVSQVEKLEDVKEVRFSDDLRVFEQMESYLN

Flanking regions ( +/- flanking 50bp)

CAATGGTTCCGCCGGGGGCGGCAAATATCGAGATGATAGGAGCTTAATTTATGTCACTACAATCACAACCTATCGCACTAGAACTTATTGTTCGTAACCATCCCGGTGTGATGACCCATATTTGTGGGCTATTTGCGCGTCGTGCATTTAACGTCGATGGTATTTTATGTTTACCAATGAAAAACAGCGATAAAAGTCGTATTTGGTTATTAGTACAAAAAGATGAGCGTTTAATGCAGATGGTGAGTCAAGTGGAAAAACTTGAGGACGTAAAAGAAGTGCGTTTTAGTGATGATCTGCGCGTTTTTGAACAGATGGAAAGTTATTTAAATTAATTGCACTGTTTGTTCTGGCTCTTTTTAGGTACGAGAGAGCCAGAACCTAA