Homologs in group_2262

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_17015 FBDBKF_17015 100.0 Morganella morganii S1 ilvN acetolactate synthase small subunit
EHELCC_16575 EHELCC_16575 100.0 Morganella morganii S2 ilvN acetolactate synthase small subunit
LHKJJB_16685 LHKJJB_16685 100.0 Morganella morganii S3 ilvN acetolactate synthase small subunit
HKOGLL_17650 HKOGLL_17650 100.0 Morganella morganii S5 ilvN acetolactate synthase small subunit
F4V73_RS18475 F4V73_RS18475 95.7 Morganella psychrotolerans ilvN acetolactate synthase small subunit
PMI_RS17495 PMI_RS17495 69.1 Proteus mirabilis HI4320 ilvN acetolactate synthase small subunit

Distribution of the homologs in the orthogroup group_2262

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2262

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0ADF8 1.48e-35 119 62 1 88 1 ilvN Acetolactate synthase isozyme 1 small subunit Escherichia coli (strain K12)
P0ADF9 1.48e-35 119 62 1 88 3 ilvN Acetolactate synthase isozyme 1 small subunit Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0ADG0 1.48e-35 119 62 1 88 3 ilvN Acetolactate synthase isozyme 1 small subunit Escherichia coli O157:H7
O78451 7.54e-09 53 37 2 77 3 ilvH Acetolactate synthase small subunit Guillardia theta
Q9TLY1 1.18e-08 52 37 1 70 3 ilvH Acetolactate synthase small subunit Cyanidium caldarium
Q9MS98 1.97e-08 52 30 1 76 3 ilvH Acetolactate synthase small subunit Galdieria sulphuraria
O28555 1.13e-07 49 31 2 74 3 ilvH Probable acetolactate synthase small subunit Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
P51230 2.42e-07 48 33 1 71 3 ilvH Acetolactate synthase small subunit Porphyra purpurea
Q1XDQ7 2.57e-07 48 33 1 71 3 ilvH Acetolactate synthase small subunit Neopyropia yezoensis
Q57625 3.54e-07 48 36 1 74 3 ilvH Probable acetolactate synthase small subunit Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q55141 1.25e-06 47 35 1 71 3 ilvH Acetolactate synthase small subunit Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P9WKJ3 3.08e-06 46 29 1 74 1 ilvH Putative acetolactate synthase small subunit Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WKJ2 3.08e-06 46 29 1 74 3 ilvH Putative acetolactate synthase small subunit Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P65162 3.08e-06 46 29 1 74 3 ilvH Acetolactate synthase small subunit Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
A0QUX7 3.08e-06 46 31 3 89 1 ilvH Acetolactate synthase small subunit Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
O27492 4.47e-06 45 32 1 70 3 ilvH Probable acetolactate synthase small subunit Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
Q9FFF4 1.21e-05 45 31 1 70 1 AHASS2 Acetolactate synthase small subunit 2, chloroplastic Arabidopsis thaliana
Q59499 3.27e-05 43 29 1 74 3 ilvH Acetolactate synthase small subunit Mycobacterium avium
Q93YZ7 7.38e-05 43 33 1 69 1 AHASS1 Acetolactate synthase small subunit 1, chloroplastic Arabidopsis thaliana
Q9SMC2 0.000111 42 31 1 70 2 None Acetolactate synthase small subunit 1, chloroplastic Nicotiana plumbaginifolia
Q89AP8 0.00016 41 29 1 74 3 ilvH Acetolactate synthase small subunit Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
O33113 0.000429 40 28 1 73 3 ilvH Acetolactate synthase small subunit Mycobacterium leprae (strain TN)

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_16785
Feature type CDS
Gene ilvN
Product acetolactate synthase small subunit
Location 35730 - 36014 (strand: 1)
Length 285 (nucleotides) / 94 (amino acids)
In genomic island -

Contig

Accession ZDB_534
Length 68509 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2262
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF22629 AHAS-like ACT domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0440 Amino acid transport and metabolism (E) E Acetolactate synthase, small subunit

Kegg Ortholog Annotation(s)

Protein Sequence

MEKNNQPIALELVVRNHPGVMTHICGLFARRAFNVDGILCLPLPGQDHSHIWLLVKSDDRLSQMVSQVEKLEDVQDVKYNEDISIFEQLNKYIQ

Flanking regions ( +/- flanking 50bp)

GGTGATGCCAATATCGATATGGTCACAGCCTGATGACGGAGAACAGAATCATGGAAAAAAATAATCAGCCTATCGCTCTGGAACTGGTGGTCCGCAACCACCCCGGTGTTATGACGCACATTTGTGGTCTGTTTGCCCGCCGGGCGTTTAACGTGGACGGCATTCTGTGTCTGCCGCTGCCGGGACAGGATCACAGCCATATCTGGCTGCTGGTGAAATCGGATGATCGACTAAGCCAGATGGTCAGTCAGGTGGAAAAACTGGAAGACGTGCAGGACGTGAAATACAACGAAGACATCAGTATCTTTGAGCAACTGAATAAATACATTCAGTAGAATGATGAAACCGGGCAGATAAGCCCGGTTTTTTGTCTGTGGTTACGGCG