Homologs in group_232

Help

7 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_01035 FBDBKF_01035 27.8 Morganella morganii S1 der ribosome biogenesis GTPase Der
EHELCC_00510 EHELCC_00510 27.8 Morganella morganii S2 der ribosome biogenesis GTPase Der
NLDBIP_02950 NLDBIP_02950 27.8 Morganella morganii S4 der ribosome biogenesis GTPase Der
LHKJJB_04465 LHKJJB_04465 27.8 Morganella morganii S3 der ribosome biogenesis GTPase Der
HKOGLL_02580 HKOGLL_02580 27.8 Morganella morganii S5 der ribosome biogenesis GTPase Der
F4V73_RS07110 F4V73_RS07110 27.8 Morganella psychrotolerans der ribosome biogenesis GTPase Der
PMI_RS09085 PMI_RS09085 28.0 Proteus mirabilis HI4320 der ribosome biogenesis GTPase Der

Distribution of the homologs in the orthogroup group_232

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_232

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P52131 1.94e-74 232 43 3 287 4 yfjP Uncharacterized protein YfjP Escherichia coli (strain K12)
P75678 1.85e-71 224 41 2 277 4 ykfA Uncharacterized protein YkfA Escherichia coli (strain K12)
P76359 1.78e-42 148 41 3 186 5 yeeP Putative uncharacterized protein YeeP Escherichia coli (strain K12)
O67800 7e-10 62 25 6 195 1 era GTPase Era Aquifex aeolicus (strain VF5)
Q89Z26 1.26e-09 62 25 12 272 3 mnmE tRNA modification GTPase MnmE Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
A6Q3D6 1.66e-09 61 26 6 192 3 mnmE tRNA modification GTPase MnmE Nitratiruptor sp. (strain SB155-2)
Q6MPP2 2.06e-09 59 28 4 133 3 engB Probable GTP-binding protein EngB Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)
Q5WHD9 3.14e-09 60 23 6 186 3 era GTPase Era Shouchella clausii (strain KSM-K16)
B0K708 4.06e-09 60 23 5 187 3 era GTPase Era Thermoanaerobacter sp. (strain X514)
B0KA54 4.06e-09 60 23 5 187 3 era GTPase Era Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E)
C4ZD63 1.73e-08 58 25 6 209 3 der GTPase Der Agathobacter rectalis (strain ATCC 33656 / DSM 3377 / JCM 17463 / KCTC 5835 / VPI 0990)
Q98RC1 2.31e-08 58 26 5 188 3 der GTPase Der Mycoplasmopsis pulmonis (strain UAB CTIP)
A7H372 3.49e-08 57 29 2 121 3 mnmE tRNA modification GTPase MnmE Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97)
Q6MUE7 4.57e-08 57 22 3 160 3 mnmE tRNA modification GTPase MnmE Mycoplasma mycoides subsp. mycoides SC (strain CCUG 32753 / NCTC 10114 / PG1)
O51881 4.66e-08 57 27 4 144 3 der GTPase Der Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
B7I5H1 4.93e-08 57 30 3 136 3 der GTPase Der Acinetobacter baumannii (strain AB0057)
C0QA05 5.06e-08 57 26 7 213 3 der GTPase Der Desulforapulum autotrophicum (strain ATCC 43914 / DSM 3382 / VKM B-1955 / HRM2)
A8FM10 6.25e-08 57 29 2 121 3 mnmE tRNA modification GTPase MnmE Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
Q5HUK3 8.68e-08 56 29 2 121 3 mnmE tRNA modification GTPase MnmE Campylobacter jejuni (strain RM1221)
Q30T75 9.39e-08 56 31 3 122 3 mnmE tRNA modification GTPase MnmE Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251)
A9KLK7 9.85e-08 56 26 5 208 3 der GTPase Der Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg)
Q2S6M6 1.01e-07 56 26 6 190 3 mnmE tRNA modification GTPase MnmE Hahella chejuensis (strain KCTC 2396)
Q8RB50 1.18e-07 55 22 5 187 3 era GTPase Era Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
A5G9V3 1.46e-07 55 25 6 177 3 mnmE tRNA modification GTPase MnmE Geotalea uraniireducens (strain Rf4)
B1HTJ0 1.69e-07 55 21 5 187 3 era GTPase Era Lysinibacillus sphaericus (strain C3-41)
A5CY46 2.11e-07 55 26 5 179 3 mnmE tRNA modification GTPase MnmE Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI)
C4Z0C8 2.27e-07 55 23 5 203 3 der GTPase Der Lachnospira eligens (strain ATCC 27750 / DSM 3376 / VPI C15-48 / C15-B4)
Q5GSS9 2.33e-07 53 32 10 177 3 engB Probable GTP-binding protein EngB Wolbachia sp. subsp. Brugia malayi (strain TRS)
Q9PNX9 2.34e-07 55 28 2 121 3 mnmE tRNA modification GTPase MnmE Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
A9VTM0 2.41e-07 55 19 4 247 3 mnmE tRNA modification GTPase MnmE Bacillus mycoides (strain KBAB4)
A1VZU7 2.43e-07 55 28 2 121 3 mnmE tRNA modification GTPase MnmE Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
C1CXC1 2.58e-07 54 22 7 235 3 era GTPase Era Deinococcus deserti (strain DSM 17065 / CIP 109153 / LMG 22923 / VCD115)
C5CIV1 2.59e-07 55 24 6 203 3 der GTPase Der Kosmotoga olearia (strain ATCC BAA-1733 / DSM 21960 / TBF 19.5.1)
B3CL86 2.91e-07 53 43 3 78 3 engB Probable GTP-binding protein EngB Wolbachia pipientis subsp. Culex pipiens (strain wPip)
P47577 3.33e-07 53 29 7 173 3 engB Probable GTP-binding protein EngB Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
Q2SR47 3.63e-07 54 21 3 160 3 mnmE tRNA modification GTPase MnmE Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154)
Q9TLX6 3.86e-07 54 24 4 188 3 mnmE Probable tRNA modification GTPase MnmE Cyanidium caldarium
Q8R6K8 4.02e-07 54 27 2 133 3 mnmE tRNA modification GTPase MnmE Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q4A578 4.23e-07 54 25 8 195 3 infB Translation initiation factor IF-2 Mycoplasmopsis synoviae (strain 53)
P42182 4.92e-07 53 21 5 187 1 era GTPase Era Bacillus subtilis (strain 168)
A6Q4R8 5.15e-07 54 29 1 106 3 der GTPase Der Nitratiruptor sp. (strain SB155-2)
A6Q4R8 0.000645 44 24 1 120 3 der GTPase Der Nitratiruptor sp. (strain SB155-2)
B6JM65 5.79e-07 53 30 2 110 3 der GTPase Der Helicobacter pylori (strain P12)
B6JM65 6.48e-06 50 24 5 183 3 der GTPase Der Helicobacter pylori (strain P12)
A7HN01 6.71e-07 53 21 3 132 3 infB Translation initiation factor IF-2 Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1)
C0R5M1 6.8e-07 52 43 3 78 3 engB Probable GTP-binding protein EngB Wolbachia sp. subsp. Drosophila simulans (strain wRi)
Q2FY06 6.86e-07 53 23 6 187 3 era GTPase Era Staphylococcus aureus (strain NCTC 8325 / PS 47)
P64086 6.92e-07 53 23 6 187 3 era GTPase Era Staphylococcus aureus (strain MW2)
A8Z4A6 6.92e-07 53 23 6 187 3 era GTPase Era Staphylococcus aureus (strain USA300 / TCH1516)
Q6G900 6.92e-07 53 23 6 187 3 era GTPase Era Staphylococcus aureus (strain MSSA476)
Q6GGD3 6.92e-07 53 23 6 187 3 era GTPase Era Staphylococcus aureus (strain MRSA252)
P64085 6.92e-07 53 23 6 187 1 era GTPase Era Staphylococcus aureus (strain N315)
P64084 6.92e-07 53 23 6 187 3 era GTPase Era Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QHB0 6.92e-07 53 23 6 187 3 era GTPase Era Staphylococcus aureus (strain Newman)
Q5HFJ3 6.92e-07 53 23 6 187 3 era GTPase Era Staphylococcus aureus (strain COL)
A5IT95 6.92e-07 53 23 6 187 3 era GTPase Era Staphylococcus aureus (strain JH9)
Q2FGF6 6.92e-07 53 23 6 187 3 era GTPase Era Staphylococcus aureus (strain USA300)
A6U239 6.92e-07 53 23 6 187 3 era GTPase Era Staphylococcus aureus (strain JH1)
A7X2W5 6.92e-07 53 23 6 187 3 era GTPase Era Staphylococcus aureus (strain Mu3 / ATCC 700698)
B1ILK9 7.22e-07 53 23 5 184 3 era GTPase Era Clostridium botulinum (strain Okra / Type B1)
C3L3F3 7.56e-07 53 23 5 184 3 era GTPase Era Clostridium botulinum (strain 657 / Type Ba4)
B1KZM3 8.44e-07 53 23 5 184 3 era GTPase Era Clostridium botulinum (strain Loch Maree / Type A3)
C1FVS6 9.52e-07 52 23 5 184 3 era GTPase Era Clostridium botulinum (strain Kyoto / Type A2)
B0K8H9 9.86e-07 53 27 2 133 3 mnmE tRNA modification GTPase MnmE Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E)
C4K4J2 9.89e-07 53 26 7 183 3 der GTPase Der Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
B0K5N4 1.02e-06 53 27 2 133 3 mnmE tRNA modification GTPase MnmE Thermoanaerobacter sp. (strain X514)
B8I442 1.06e-06 53 24 6 210 3 der GTPase Der Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10)
B7IE34 1.07e-06 53 34 1 98 3 der GTPase Der Thermosipho africanus (strain TCF52B)
Q6HAF2 1.18e-06 53 23 2 139 3 mnmE tRNA modification GTPase MnmE Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q81JD9 1.18e-06 53 23 2 139 3 mnmE tRNA modification GTPase MnmE Bacillus anthracis
A5I626 1.2e-06 52 23 5 184 3 era GTPase Era Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)
A7FXK1 1.2e-06 52 23 5 184 3 era GTPase Era Clostridium botulinum (strain ATCC 19397 / Type A)
Q6MFA3 1.2e-06 53 27 4 162 3 mnmE tRNA modification GTPase MnmE Protochlamydia amoebophila (strain UWE25)
Q630B8 1.22e-06 53 23 2 139 3 mnmE tRNA modification GTPase MnmE Bacillus cereus (strain ZK / E33L)
B5Z7J9 1.23e-06 53 27 2 121 3 der GTPase Der Helicobacter pylori (strain G27)
B5Z7J9 9.36e-06 50 24 5 183 3 der GTPase Der Helicobacter pylori (strain G27)
A0RLR2 1.25e-06 52 23 2 139 3 mnmE tRNA modification GTPase MnmE Bacillus thuringiensis (strain Al Hakam)
O25505 1.26e-06 52 29 1 101 3 der GTPase Der Helicobacter pylori (strain ATCC 700392 / 26695)
O25505 2.59e-06 52 25 5 183 3 der GTPase Der Helicobacter pylori (strain ATCC 700392 / 26695)
B2USZ4 1.27e-06 52 27 2 121 3 der GTPase Der Helicobacter pylori (strain Shi470)
B2USZ4 1.36e-05 49 24 5 183 3 der GTPase Der Helicobacter pylori (strain Shi470)
A7GHG2 1.28e-06 52 23 5 184 3 era GTPase Era Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)
Q9ZL09 1.3e-06 52 27 2 121 3 der GTPase Der Helicobacter pylori (strain J99 / ATCC 700824)
Q9ZL09 1.6e-05 49 24 5 183 3 der GTPase Der Helicobacter pylori (strain J99 / ATCC 700824)
C5BES7 1.34e-06 52 26 3 127 3 der GTPase Der Edwardsiella ictaluri (strain 93-146)
Q5SM23 1.4e-06 52 25 2 140 1 era GTPase Era Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
A6QAL0 1.45e-06 52 25 6 172 3 mnmE tRNA modification GTPase MnmE Sulfurovum sp. (strain NBC37-1)
Q2YT12 1.5e-06 52 25 4 135 3 era GTPase Era Staphylococcus aureus (strain bovine RF122 / ET3-1)
A0RQK2 1.73e-06 52 28 8 182 3 der GTPase Der Campylobacter fetus subsp. fetus (strain 82-40)
Q04ZS1 1.8e-06 52 25 6 189 3 der GTPase Der Leptospira borgpetersenii serovar Hardjo-bovis (strain L550)
Q04ZS1 0.000437 45 27 5 132 3 der GTPase Der Leptospira borgpetersenii serovar Hardjo-bovis (strain L550)
Q04TV4 1.8e-06 52 25 6 189 3 der GTPase Der Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197)
Q04TV4 0.000437 45 27 5 132 3 der GTPase Der Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197)
Q67NS9 1.83e-06 52 26 4 189 3 der GTPase Der Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
B2SUV8 1.84e-06 52 39 2 89 3 mnmE tRNA modification GTPase MnmE Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q5GTT5 1.86e-06 52 39 2 89 3 mnmE tRNA modification GTPase MnmE Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
Q2NX54 1.88e-06 52 39 2 89 3 mnmE tRNA modification GTPase MnmE Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q7M7W8 1.91e-06 52 29 7 188 3 der GTPase Der Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
Q7M7W8 7.42e-06 50 27 4 133 3 der GTPase Der Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
A7GVP7 1.92e-06 52 24 4 149 3 mnmE tRNA modification GTPase MnmE Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
Q661B2 2.06e-06 52 24 3 134 3 der GTPase Der Borrelia garinii subsp. bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi)
Q6AEC6 2.07e-06 51 24 9 241 3 era GTPase Era Leifsonia xyli subsp. xyli (strain CTCB07)
Q3BLZ9 2.11e-06 52 39 2 89 3 mnmE tRNA modification GTPase MnmE Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q7VFY6 2.19e-06 52 27 7 184 3 der GTPase Der Helicobacter hepaticus (strain ATCC 51449 / 3B1)
Q7VFY6 1.59e-05 49 28 5 134 3 der GTPase Der Helicobacter hepaticus (strain ATCC 51449 / 3B1)
Q7NAD9 2.23e-06 52 24 4 144 3 mnmE tRNA modification GTPase MnmE Mycoplasmoides gallisepticum (strain R(low / passage 15 / clone 2))
Q8P340 2.25e-06 52 39 2 89 3 mnmE tRNA modification GTPase MnmE Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RMM4 2.25e-06 52 39 2 89 3 mnmE tRNA modification GTPase MnmE Xanthomonas campestris pv. campestris (strain B100)
Q4UNL0 2.25e-06 52 39 2 89 3 mnmE tRNA modification GTPase MnmE Xanthomonas campestris pv. campestris (strain 8004)
Q8PEH9 2.26e-06 52 37 2 95 3 mnmE tRNA modification GTPase MnmE Xanthomonas axonopodis pv. citri (strain 306)
B9DNL3 2.27e-06 51 25 3 128 3 era GTPase Era Staphylococcus carnosus (strain TM300)
Q1LU74 2.28e-06 52 27 4 136 3 der GTPase Der Baumannia cicadellinicola subsp. Homalodisca coagulata
Q11TG8 2.35e-06 52 23 5 192 3 mnmE tRNA modification GTPase MnmE Cytophaga hutchinsonii (strain ATCC 33406 / DSM 1761 / CIP 103989 / NBRC 15051 / NCIMB 9469 / D465)
Q73IC3 2.53e-06 50 42 3 78 3 engB Probable GTP-binding protein EngB Wolbachia pipientis wMel
Q72WU3 2.61e-06 52 23 2 139 3 mnmE tRNA modification GTPase MnmE Bacillus cereus (strain ATCC 10987 / NRS 248)
O67030 2.68e-06 52 23 5 201 3 mnmE tRNA modification GTPase MnmE Aquifex aeolicus (strain VF5)
P38424 2.77e-06 50 28 7 160 1 engB Probable GTP-binding protein EngB Bacillus subtilis (strain 168)
Q814F6 2.79e-06 52 19 4 241 3 mnmE tRNA modification GTPase MnmE Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q38WW3 2.86e-06 51 26 8 198 3 der GTPase Der Latilactobacillus sakei subsp. sakei (strain 23K)
Q38WW3 0.000364 45 24 4 139 3 der GTPase Der Latilactobacillus sakei subsp. sakei (strain 23K)
Q89A14 2.93e-06 52 27 4 129 3 der GTPase Der Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q92JC9 3.05e-06 50 41 3 70 3 engB Probable GTP-binding protein EngB Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Q7URJ8 3.35e-06 51 24 5 145 3 der GTPase Der Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
B9L7G9 3.41e-06 51 26 7 189 3 der GTPase Der Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH)
Q899S2 3.46e-06 51 21 5 196 3 mnmE tRNA modification GTPase MnmE Clostridium tetani (strain Massachusetts / E88)
A8FJG0 3.59e-06 51 27 3 137 3 mnmE tRNA modification GTPase MnmE Bacillus pumilus (strain SAFR-032)
B2S3S8 3.63e-06 51 25 7 179 3 der GTPase Der Treponema pallidum subsp. pallidum (strain SS14)
P96128 3.63e-06 51 25 7 179 3 der GTPase Der Treponema pallidum (strain Nichols)
Q8EPY0 3.63e-06 51 24 6 187 3 era GTPase Era Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q17WL7 4.13e-06 51 25 5 184 3 der GTPase Der Helicobacter acinonychis (strain Sheeba)
Q17WL7 4.81e-06 51 29 2 110 3 der GTPase Der Helicobacter acinonychis (strain Sheeba)
Q1RH06 4.21e-06 50 40 4 90 3 engB Probable GTP-binding protein EngB Rickettsia bellii (strain RML369-C)
A8GUK6 4.21e-06 50 40 4 90 3 engB Probable GTP-binding protein EngB Rickettsia bellii (strain OSU 85-389)
Q5FGZ3 4.24e-06 50 36 4 94 3 engB Probable GTP-binding protein EngB Ehrlichia ruminantium (strain Gardel)
Q4L6R7 4.26e-06 50 25 3 128 3 era GTPase Era Staphylococcus haemolyticus (strain JCSC1435)
Q5HB81 4.28e-06 50 36 4 94 3 engB Probable GTP-binding protein EngB Ehrlichia ruminantium (strain Welgevonden)
Q1MS56 4.31e-06 51 22 7 198 3 der GTPase Der Lawsonia intracellularis (strain PHE/MN1-00)
Q1QD14 4.32e-06 51 29 2 108 3 der GTPase Der Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q1MPF1 4.42e-06 51 29 4 134 3 mnmE tRNA modification GTPase MnmE Lawsonia intracellularis (strain PHE/MN1-00)
Q2LVW9 4.5e-06 49 32 7 133 3 engB Probable GTP-binding protein EngB Syntrophus aciditrophicus (strain SB)
Q0SMZ9 4.52e-06 51 26 2 108 3 der GTPase Der Borreliella afzelii (strain PKo)
B9KFN5 4.55e-06 51 25 6 189 3 der GTPase Der Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060)
B9KFN5 0.000771 44 31 1 74 3 der GTPase Der Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060)
A7ZBS1 4.56e-06 51 28 8 176 3 der GTPase Der Campylobacter concisus (strain 13826)
Q4FTW3 4.61e-06 51 29 2 108 3 der GTPase Der Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
B3WE80 4.62e-06 51 24 9 235 3 der GTPase Der Lacticaseibacillus casei (strain BL23)
Q039G4 4.66e-06 51 24 9 235 3 der GTPase Der Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
Q7VJY2 4.75e-06 51 27 2 122 3 mnmE tRNA modification GTPase MnmE Helicobacter hepaticus (strain ATCC 51449 / 3B1)
A7H4Z1 4.76e-06 51 28 6 135 3 der GTPase Der Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97)
A7H4Z1 0.000132 46 26 6 184 3 der GTPase Der Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97)
A4XKV8 4.82e-06 50 28 3 124 3 era GTPase Era Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331)
Q8F9P7 4.85e-06 50 34 2 83 3 engB Probable GTP-binding protein EngB Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q72W11 4.85e-06 50 34 2 83 3 engB Probable GTP-binding protein EngB Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
Q8XIU8 5.2e-06 50 22 5 208 3 era GTPase Era Clostridium perfringens (strain 13 / Type A)
A2BNY4 5.4e-06 50 21 7 238 3 mnmE tRNA modification GTPase MnmE Prochlorococcus marinus (strain AS9601)
A8GQS1 5.48e-06 49 41 3 70 3 engB Probable GTP-binding protein EngB Rickettsia rickettsii (strain Sheila Smith)
C4K1B9 6.31e-06 49 41 3 70 3 engB Probable GTP-binding protein EngB Rickettsia peacockii (strain Rustic)
C1F4C3 6.37e-06 49 29 5 135 3 engB Probable GTP-binding protein EngB Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / BCRC 80197 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161)
B2S3D3 6.47e-06 50 26 8 202 3 era GTPase Era Treponema pallidum subsp. pallidum (strain SS14)
O83552 6.47e-06 50 26 8 202 3 era GTPase Era Treponema pallidum (strain Nichols)
Q0SRG1 6.6e-06 50 22 5 208 3 era GTPase Era Clostridium perfringens (strain SM101 / Type A)
Q6AGF6 6.61e-06 50 26 7 196 3 der GTPase Der Leifsonia xyli subsp. xyli (strain CTCB07)
Q7VWL4 6.7e-06 50 25 3 131 3 der GTPase Der Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7W6Q0 6.7e-06 50 25 3 131 3 der GTPase Der Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WHN4 6.7e-06 50 25 3 131 3 der GTPase Der Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
A8G2J5 7.08e-06 50 23 3 140 3 mnmE tRNA modification GTPase MnmE Prochlorococcus marinus (strain MIT 9215)
Q7M901 7.24e-06 50 29 3 122 3 mnmE tRNA modification GTPase MnmE Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
Q11QK1 7.25e-06 50 22 6 196 3 der GTPase Der Cytophaga hutchinsonii (strain ATCC 33406 / DSM 1761 / CIP 103989 / NBRC 15051 / NCIMB 9469 / D465)
Q1CT35 7.28e-06 50 28 1 101 3 der GTPase Der Helicobacter pylori (strain HPAG1)
Q1CT35 0.000241 45 23 5 183 3 der GTPase Der Helicobacter pylori (strain HPAG1)
Q9WYA4 7.66e-06 50 26 3 136 1 mnmE tRNA modification GTPase MnmE Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q17ZA7 8.16e-06 50 32 1 80 3 mnmE tRNA modification GTPase MnmE Helicobacter acinonychis (strain Sheeba)
Q03SA1 8.53e-06 50 25 8 185 3 der GTPase Der Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
B1L9N6 8.61e-06 50 26 3 136 3 mnmE tRNA modification GTPase MnmE Thermotoga sp. (strain RQ2)
Q9KD52 8.79e-06 50 22 2 125 3 era GTPase Era Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
C1AB49 8.82e-06 48 28 9 191 3 engB Probable GTP-binding protein EngB Gemmatimonas aurantiaca (strain DSM 14586 / JCM 11422 / NBRC 100505 / T-27)
A7HZI3 8.87e-06 50 24 7 186 3 der GTPase Der Campylobacter hominis (strain ATCC BAA-381 / DSM 21671 / CCUG 45161 / LMG 19568 / NCTC 13146 / CH001A)
Q5HNY0 9.03e-06 49 22 6 187 3 era GTPase Era Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q8CP21 9.2e-06 49 22 6 187 3 era GTPase Era Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
A5IZG5 9.27e-06 50 25 6 192 3 der GTPase Der Mycoplasmopsis agalactiae (strain NCTC 10123 / CIP 59.7 / PG2)
Q8YYD8 9.46e-06 50 24 6 190 3 era GTPase Era Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
A1QYX4 9.75e-06 50 26 4 141 3 mnmE tRNA modification GTPase MnmE Borrelia turicatae (strain 91E135)
A8GM60 9.81e-06 48 41 3 70 3 engB Probable GTP-binding protein EngB Rickettsia akari (strain Hartford)
Q4UNC2 9.91e-06 48 41 3 70 3 engB Probable GTP-binding protein EngB Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
B7IH25 9.98e-06 49 26 3 138 3 era GTPase Era Thermosipho africanus (strain TCF52B)
Q2ILB9 1.02e-05 48 27 6 144 3 engB Probable GTP-binding protein EngB Anaeromyxobacter dehalogenans (strain 2CP-C)
Q9PRC7 1.04e-05 50 26 5 142 3 mnmE tRNA modification GTPase MnmE Ureaplasma parvum serovar 3 (strain ATCC 700970)
B1AI04 1.04e-05 50 26 5 142 3 mnmE tRNA modification GTPase MnmE Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736)
B4UHX9 1.05e-05 48 27 6 144 3 engB Probable GTP-binding protein EngB Anaeromyxobacter sp. (strain K)
B8JEQ8 1.05e-05 48 27 6 144 3 engB Probable GTP-binding protein EngB Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258)
Q31CZ2 1.07e-05 50 23 3 140 3 mnmE tRNA modification GTPase MnmE Prochlorococcus marinus (strain MIT 9312)
Q3AAU6 1.13e-05 50 25 7 201 3 der GTPase Der Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
A5IKF4 1.14e-05 50 26 3 136 3 mnmE tRNA modification GTPase MnmE Thermotoga petrophila (strain ATCC BAA-488 / DSM 13995 / JCM 10881 / RKU-1)
A8FFV6 1.15e-05 48 28 6 139 3 engB Probable GTP-binding protein EngB Bacillus pumilus (strain SAFR-032)
B1HPM3 1.15e-05 50 25 2 133 3 mnmE tRNA modification GTPase MnmE Lysinibacillus sphaericus (strain C3-41)
O51461 1.18e-05 50 26 2 108 3 der GTPase Der Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31)
B0KPJ1 1.2e-05 50 22 4 189 3 der GTPase Der Pseudomonas putida (strain GB-1)
A5N6N6 1.2e-05 49 23 5 184 3 era GTPase Era Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680)
B9E055 1.2e-05 49 23 5 184 3 era GTPase Era Clostridium kluyveri (strain NBRC 12016)
Q0TNU5 1.28e-05 49 26 2 125 3 era GTPase Era Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
A5VYT9 1.34e-05 49 22 4 189 3 der GTPase Der Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q0SPQ3 1.39e-05 49 23 5 194 3 mnmE tRNA modification GTPase MnmE Clostridium perfringens (strain SM101 / Type A)
Q64X55 1.52e-05 49 22 11 265 3 mnmE tRNA modification GTPase MnmE Bacteroides fragilis (strain YCH46)
B9K8E0 1.53e-05 49 25 4 189 3 der GTPase Der Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NBRC 107923 / NS-E)
A5WGA8 1.57e-05 49 24 1 111 3 der GTPase Der Psychrobacter sp. (strain PRwf-1)
A3PAQ7 1.58e-05 49 23 3 140 3 mnmE tRNA modification GTPase MnmE Prochlorococcus marinus (strain MIT 9301)
C3PMD9 1.58e-05 48 41 3 70 3 engB Probable GTP-binding protein EngB Rickettsia africae (strain ESF-5)
Q1IXB4 1.66e-05 49 28 1 100 3 era GTPase Era Deinococcus geothermalis (strain DSM 11300 / CIP 105573 / AG-3a)
A8ZU05 1.66e-05 49 25 8 208 3 der GTPase Der Desulfosudis oleivorans (strain DSM 6200 / JCM 39069 / Hxd3)
Q8XH30 1.69e-05 49 23 5 194 3 mnmE tRNA modification GTPase MnmE Clostridium perfringens (strain 13 / Type A)
Q0TLZ4 1.69e-05 49 23 5 194 3 mnmE tRNA modification GTPase MnmE Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
A7GYZ1 1.78e-05 49 26 4 123 3 mnmE tRNA modification GTPase MnmE Campylobacter curvus (strain 525.92)
B2V5W6 1.81e-05 49 24 6 186 3 der GTPase Der Sulfurihydrogenibium sp. (strain YO3AOP1)
Q5LG80 1.85e-05 49 22 12 270 3 mnmE tRNA modification GTPase MnmE Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
Q30YQ7 1.87e-05 49 30 3 119 3 mnmE tRNA modification GTPase MnmE Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
A1AXR3 1.88e-05 49 28 3 121 3 mnmE tRNA modification GTPase MnmE Ruthia magnifica subsp. Calyptogena magnifica
Q49UI4 1.92e-05 49 25 6 201 3 mnmE tRNA modification GTPase MnmE Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
B3QS35 2.02e-05 47 31 6 133 3 engB Probable GTP-binding protein EngB Chloroherpeton thalassium (strain ATCC 35110 / GB-78)
A8MG70 2.06e-05 48 21 5 187 3 era GTPase Era Alkaliphilus oremlandii (strain OhILAs)
Q8RGV7 2.12e-05 49 24 7 200 3 der GTPase Der Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q746Q3 2.25e-05 48 24 4 224 3 mnmE tRNA modification GTPase MnmE Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Q88PJ3 2.27e-05 49 22 4 189 3 der GTPase Der Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
A6TSJ8 2.28e-05 48 21 5 184 3 era GTPase Era Alkaliphilus metalliredigens (strain QYMF)
Q47WC5 2.67e-05 48 24 3 165 3 der GTPase Der Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q2GGM7 2.75e-05 47 35 6 105 3 engB Probable GTP-binding protein EngB Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas)
B9MS56 2.76e-05 48 28 4 125 3 era GTPase Era Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / KCTC 15123 / Z-1320)
C4XIQ6 3.02e-05 48 29 9 187 3 der GTPase Der Solidesulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1)
B0JVV0 3.12e-05 48 23 2 134 3 mnmE tRNA modification GTPase MnmE Microcystis aeruginosa (strain NIES-843 / IAM M-2473)
B0TAB6 3.15e-05 48 27 7 182 3 mnmE tRNA modification GTPase MnmE Heliobacterium modesticaldum (strain ATCC 51547 / Ice1)
Q3K7C0 3.2e-05 48 22 4 186 3 der GTPase Der Pseudomonas fluorescens (strain Pf0-1)
Q931E1 3.45e-05 48 25 5 200 3 mnmE tRNA modification GTPase MnmE Staphylococcus aureus (strain Mu50 / ATCC 700699)
A7X7A8 3.45e-05 48 25 5 200 3 mnmE tRNA modification GTPase MnmE Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q8F6K1 3.46e-05 48 23 6 189 3 der GTPase Der Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q72PQ1 3.46e-05 48 23 6 189 3 der GTPase Der Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
A8FKH3 3.49e-05 48 24 6 219 3 der GTPase Der Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
A8FKH3 5.57e-05 47 27 5 134 3 der GTPase Der Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
Q6G5W4 3.52e-05 48 25 5 200 3 mnmE tRNA modification GTPase MnmE Staphylococcus aureus (strain MSSA476)
Q9WZV1 3.53e-05 48 30 1 105 3 era GTPase Era Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
A7H4F3 3.54e-05 48 33 0 62 3 era GTPase Era Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97)
P57662 3.62e-05 48 26 4 136 3 der GTPase Der Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B8D8G4 3.62e-05 48 26 4 136 3 der GTPase Der Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
Q2YZB8 3.64e-05 48 25 5 200 3 mnmE tRNA modification GTPase MnmE Staphylococcus aureus (strain bovine RF122 / ET3-1)
B8GTN1 3.7e-05 48 25 2 135 3 der GTPase Der Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
A4XHX9 3.76e-05 48 25 6 193 3 der GTPase Der Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331)
Q88VS0 3.79e-05 48 23 6 191 3 era GTPase Era Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
A6L6E8 3.86e-05 48 25 5 135 3 mnmE tRNA modification GTPase MnmE Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154)
A8YYS1 3.88e-05 48 25 5 200 3 mnmE tRNA modification GTPase MnmE Staphylococcus aureus (strain USA300 / TCH1516)
A6QKK2 3.88e-05 48 25 5 200 3 mnmE tRNA modification GTPase MnmE Staphylococcus aureus (strain Newman)
Q5HCI3 3.88e-05 48 25 5 200 3 mnmE tRNA modification GTPase MnmE Staphylococcus aureus (strain COL)
Q2FDE8 3.88e-05 48 25 5 200 3 mnmE tRNA modification GTPase MnmE Staphylococcus aureus (strain USA300)
B8D8C1 3.89e-05 48 26 4 136 3 der GTPase Der Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
P66973 3.92e-05 48 25 5 200 3 mnmE tRNA modification GTPase MnmE Staphylococcus aureus (strain MW2)
Q6GD92 3.92e-05 48 25 5 200 3 mnmE tRNA modification GTPase MnmE Staphylococcus aureus (strain MRSA252)
P66972 3.92e-05 48 25 5 200 3 mnmE tRNA modification GTPase MnmE Staphylococcus aureus (strain N315)
A5IWD7 3.92e-05 48 25 5 200 3 mnmE tRNA modification GTPase MnmE Staphylococcus aureus (strain JH9)
Q2FUQ2 3.92e-05 48 25 5 200 3 mnmE tRNA modification GTPase MnmE Staphylococcus aureus (strain NCTC 8325 / PS 47)
A6U595 3.92e-05 48 25 5 200 3 mnmE tRNA modification GTPase MnmE Staphylococcus aureus (strain JH1)
Q831T9 4.05e-05 47 20 6 185 3 era GTPase Era Enterococcus faecalis (strain ATCC 700802 / V583)
C0QT02 4.08e-05 48 23 4 182 3 der GTPase Der Persephonella marina (strain DSM 14350 / EX-H1)
B1IBH5 4.24e-05 48 25 3 132 3 mnmE tRNA modification GTPase MnmE Streptococcus pneumoniae (strain Hungary19A-6)
C5CEL1 4.32e-05 47 31 5 128 3 engB Probable GTP-binding protein EngB Kosmotoga olearia (strain ATCC BAA-1733 / DSM 21960 / TBF 19.5.1)
A1VYA6 4.37e-05 48 24 6 219 3 der GTPase Der Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
A1VYA6 5.62e-05 47 28 6 135 3 der GTPase Der Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
Q5HW81 4.49e-05 48 28 6 135 3 der GTPase Der Campylobacter jejuni (strain RM1221)
Q5HW81 4.53e-05 48 27 6 184 3 der GTPase Der Campylobacter jejuni (strain RM1221)
Q9PIB6 4.49e-05 48 28 6 135 3 der GTPase Der Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Q9PIB6 4.53e-05 48 27 6 184 3 der GTPase Der Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Q8DPZ8 4.51e-05 48 25 3 132 3 mnmE tRNA modification GTPase MnmE Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q97R24 4.51e-05 48 25 3 132 3 mnmE tRNA modification GTPase MnmE Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q04KR8 4.51e-05 48 25 3 132 3 mnmE tRNA modification GTPase MnmE Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
A4VX53 4.53e-05 48 25 3 129 3 der GTPase Der Streptococcus suis (strain 05ZYH33)
A4W3F7 4.53e-05 48 25 3 129 3 der GTPase Der Streptococcus suis (strain 98HAH33)
A7GWZ2 4.74e-05 48 28 8 173 3 der GTPase Der Campylobacter curvus (strain 525.92)
Q119L7 4.96e-05 48 24 4 179 3 der GTPase Der Trichodesmium erythraeum (strain IMS101)
A5CVJ3 5.11e-05 48 28 3 121 3 mnmE tRNA modification GTPase MnmE Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA)
A4XY28 5.25e-05 48 26 2 126 3 der GTPase Der Pseudomonas mendocina (strain ymp)
Q6MEP0 5.32e-05 47 29 6 131 3 engB Probable GTP-binding protein EngB Protochlamydia amoebophila (strain UWE25)
Q5KXT0 5.37e-05 47 30 5 129 3 der GTPase Der Geobacillus kaustophilus (strain HTA426)
A5IIT6 5.52e-05 47 29 1 107 3 era GTPase Era Thermotoga petrophila (strain ATCC BAA-488 / DSM 13995 / JCM 10881 / RKU-1)
A4IQA2 5.57e-05 47 30 5 129 3 der GTPase Der Geobacillus thermodenitrificans (strain NG80-2)
A4IQA2 0.000138 46 26 3 110 3 der GTPase Der Geobacillus thermodenitrificans (strain NG80-2)
A6LDT9 5.83e-05 47 35 1 68 3 mnmE tRNA modification GTPase MnmE Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)
Q1CRH7 5.83e-05 47 32 1 80 3 mnmE tRNA modification GTPase MnmE Helicobacter pylori (strain HPAG1)
A9IK66 6.14e-05 47 23 3 131 3 der GTPase Der Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
A6LL68 6.19e-05 47 28 2 121 3 era GTPase Era Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429)
Q3YS22 6.23e-05 46 36 3 73 3 engB Probable GTP-binding protein EngB Ehrlichia canis (strain Jake)
Q6F2A3 6.43e-05 47 25 4 128 3 mnmE tRNA modification GTPase MnmE Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1)
A5IMB8 6.51e-05 46 37 3 74 3 engB Probable GTP-binding protein EngB Thermotoga petrophila (strain ATCC BAA-488 / DSM 13995 / JCM 10881 / RKU-1)
B2UVJ7 6.53e-05 47 32 1 80 3 mnmE tRNA modification GTPase MnmE Helicobacter pylori (strain Shi470)
C5D3F4 6.61e-05 47 29 5 129 3 der GTPase Der Geobacillus sp. (strain WCH70)
C5D3F4 0.00015 46 26 3 110 3 der GTPase Der Geobacillus sp. (strain WCH70)
A6M3M5 6.8e-05 47 26 4 136 3 mnmE tRNA modification GTPase MnmE Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
Q3ICZ9 6.84e-05 47 24 6 216 3 der GTPase Der Pseudoalteromonas translucida (strain TAC 125)
Q49Y10 7.03e-05 47 25 4 135 3 era GTPase Era Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
A7Z7A9 7.09e-05 46 29 6 139 3 engB Probable GTP-binding protein EngB Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
B3EMI7 7.35e-05 47 21 5 216 3 der GTPase Der Chlorobium phaeobacteroides (strain BS1)
O25991 7.56e-05 47 32 1 80 3 mnmE tRNA modification GTPase MnmE Helicobacter pylori (strain ATCC 700392 / 26695)
Q0AB37 7.61e-05 47 26 2 126 3 der GTPase Der Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
A8FL79 7.63e-05 47 33 0 62 3 era GTPase Era Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
A1VZ20 7.77e-05 47 33 0 62 3 era GTPase Era Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
Q9PHL1 7.77e-05 47 33 0 62 3 era GTPase Era Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Q5HVB3 7.98e-05 47 33 0 62 3 era GTPase Era Campylobacter jejuni (strain RM1221)
Q9X1H7 8.01e-05 46 37 3 74 1 engB Probable GTP-binding protein EngB Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
A8MKR9 8.06e-05 47 26 3 137 3 mnmE tRNA modification GTPase MnmE Alkaliphilus oremlandii (strain OhILAs)
B9K8C0 8.09e-05 46 39 2 68 3 engB Probable GTP-binding protein EngB Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NBRC 107923 / NS-E)
B0V4V6 8.65e-05 47 30 3 136 3 der GTPase Der Acinetobacter baumannii (strain AYE)
A3M215 8.65e-05 47 30 3 136 3 der GTPase Der Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
B2I3F0 8.65e-05 47 30 3 136 3 der GTPase Der Acinetobacter baumannii (strain ACICU)
B7H065 8.65e-05 47 30 3 136 3 der GTPase Der Acinetobacter baumannii (strain AB307-0294)
Q7MVZ2 8.85e-05 47 24 5 199 3 mnmE tRNA modification GTPase MnmE Porphyromonas gingivalis (strain ATCC BAA-308 / W83)
A0RNG2 8.91e-05 47 23 4 152 3 mnmE tRNA modification GTPase MnmE Campylobacter fetus subsp. fetus (strain 82-40)
B0VKR4 9.13e-05 47 30 3 136 3 der GTPase Der Acinetobacter baumannii (strain SDF)
B1I462 9.15e-05 47 25 5 178 3 der GTPase Der Desulforudis audaxviator (strain MP104C)
Q04XC3 9.27e-05 46 34 2 82 3 engB Probable GTP-binding protein EngB Leptospira borgpetersenii serovar Hardjo-bovis (strain L550)
Q04W49 9.27e-05 46 34 2 82 3 engB Probable GTP-binding protein EngB Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197)
Q83C83 9.29e-05 47 22 5 189 1 der GTPase Der Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9NDV6 9.29e-05 47 22 5 189 3 der GTPase Der Coxiella burnetii (strain RSA 331 / Henzerling II)
A9KFU3 9.29e-05 47 22 5 189 3 der GTPase Der Coxiella burnetii (strain Dugway 5J108-111)
B6J7Q3 9.29e-05 47 22 5 189 3 der GTPase Der Coxiella burnetii (strain CbuK_Q154)
A1TM31 9.76e-05 47 27 4 144 3 der GTPase Der Paracidovorax citrulli (strain AAC00-1)
B1LBK5 0.000104 45 37 3 74 3 engB Probable GTP-binding protein EngB Thermotoga sp. (strain RQ2)
Q9PLM9 0.000106 47 31 1 88 3 mnmE tRNA modification GTPase MnmE Chlamydia muridarum (strain MoPn / Nigg)
Q9PQH1 0.000115 47 24 3 99 3 infB Translation initiation factor IF-2 Ureaplasma parvum serovar 3 (strain ATCC 700970)
B1AIV8 0.000115 47 24 3 99 3 infB Translation initiation factor IF-2 Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736)
A8F732 0.000115 47 23 7 194 3 mnmE tRNA modification GTPase MnmE Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO)
B3E422 0.000116 46 24 2 125 3 era GTPase Era Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)
B7K414 0.000117 46 24 5 189 3 era GTPase Era Rippkaea orientalis (strain PCC 8801 / RF-1)
Q4K6V3 0.000119 47 25 2 127 3 der GTPase Der Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
B1GYZ9 0.000119 47 26 1 113 3 mnmE tRNA modification GTPase MnmE Endomicrobium trichonymphae
Q4L2Z2 0.000121 47 26 5 157 3 mnmE tRNA modification GTPase MnmE Staphylococcus haemolyticus (strain JCSC1435)
B6IZN3 0.000124 46 21 5 189 3 der GTPase Der Coxiella burnetii (strain CbuG_Q212)
B7K1S0 0.000125 46 25 4 148 3 der GTPase Der Rippkaea orientalis (strain PCC 8801 / RF-1)
Q5FKR5 0.000126 45 26 7 184 3 engB Probable GTP-binding protein EngB Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
Q9ZJG6 0.000126 46 33 1 77 3 mnmE tRNA modification GTPase MnmE Helicobacter pylori (strain J99 / ATCC 700824)
B8CWY9 0.000129 46 25 7 211 3 der GTPase Der Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562)
B3QQY9 0.000129 45 30 8 152 3 engB Probable GTP-binding protein EngB Chlorobaculum parvum (strain DSM 263 / NCIMB 8327)
Q03MB1 0.000131 46 26 2 109 3 der GTPase Der Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
Q879S5 0.000133 46 39 1 87 3 mnmE tRNA modification GTPase MnmE Xylella fastidiosa (strain Temecula1 / ATCC 700964)
Q5M5X5 0.000134 46 26 2 109 3 der GTPase Der Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q5M1D9 0.000134 46 26 2 109 3 der GTPase Der Streptococcus thermophilus (strain CNRZ 1066)
B7KHD2 0.00014 46 25 4 148 3 der GTPase Der Gloeothece citriformis (strain PCC 7424)
Q7VM29 0.000144 46 22 5 209 3 der GTPase Der Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q65CN1 0.000151 46 23 7 241 3 mnmE tRNA modification GTPase MnmE Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q895X8 0.000154 46 21 5 188 3 der GTPase Der Clostridium tetani (strain Massachusetts / E88)
A0RPN6 0.000158 46 38 0 62 3 era GTPase Era Campylobacter fetus subsp. fetus (strain 82-40)
B2UMV5 0.00016 46 23 8 234 3 der GTPase Der Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc)
A8AVL8 0.000164 46 26 2 109 3 der GTPase Der Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)
A1BJ02 0.000165 45 28 5 132 3 engB Probable GTP-binding protein EngB Chlorobium phaeobacteroides (strain DSM 266 / SMG 266 / 2430)
A7Z636 0.000167 46 25 6 187 3 der GTPase Der Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
Q7VGJ2 0.000172 45 25 9 214 3 engB Probable GTP-binding protein EngB Helicobacter hepaticus (strain ATCC 51449 / 3B1)
A4J9S1 0.000176 46 25 2 119 3 mnmE tRNA modification GTPase MnmE Desulforamulus reducens (strain ATCC BAA-1160 / DSM 100696 / MI-1)
A3CPT0 0.000176 46 27 4 111 3 der GTPase Der Streptococcus sanguinis (strain SK36)
Q1WTU6 0.000177 45 20 5 204 3 era GTPase Era Ligilactobacillus salivarius (strain UCC118)
Q30TK8 0.00018 46 44 0 56 3 der GTPase Der Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251)
Q9RWM0 0.000183 45 35 0 56 3 era GTPase Era Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
Q9HXJ8 0.000186 46 24 2 127 3 der GTPase Der Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
A6V0W4 0.000186 46 24 2 127 3 der GTPase Der Pseudomonas aeruginosa (strain PA7)
Q9P9U3 0.000187 46 38 2 89 3 mnmE tRNA modification GTPase MnmE Xylella fastidiosa (strain 9a5c)
B8CXI2 0.000188 45 24 6 188 3 era GTPase Era Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562)
B8F4X7 0.000189 46 22 5 190 3 der GTPase Der Glaesserella parasuis serovar 5 (strain SH0165)
Q5WWG8 0.000191 46 26 2 125 3 der GTPase Der Legionella pneumophila (strain Lens)
Q02RV3 0.000193 46 24 2 127 3 der GTPase Der Pseudomonas aeruginosa (strain UCBPP-PA14)
B7UWJ2 0.000195 46 24 2 127 3 der GTPase Der Pseudomonas aeruginosa (strain LESB58)
A9NE34 0.000195 46 29 2 99 3 mnmE tRNA modification GTPase MnmE Acholeplasma laidlawii (strain PG-8A)
A9KLX9 0.000197 46 25 3 126 3 mnmE tRNA modification GTPase MnmE Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg)
B2A1E8 0.000197 45 28 8 166 3 engB Probable GTP-binding protein EngB Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF)
B2THQ9 0.000202 46 25 8 201 3 der GTPase Der Clostridium botulinum (strain Eklund 17B / Type B)
Q0VKU8 0.000202 46 34 0 70 3 mnmE tRNA modification GTPase MnmE Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q89AM7 0.000203 45 26 7 133 3 era GTPase Era Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
B1JDV4 0.000204 46 23 2 126 3 der GTPase Der Pseudomonas putida (strain W619)
Q8RGM1 0.000211 45 27 1 95 3 era GTPase Era Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
A7GYN7 0.000218 45 41 2 63 3 era GTPase Era Campylobacter curvus (strain 525.92)
Q8CMN5 0.00022 46 23 6 205 3 mnmE tRNA modification GTPase MnmE Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HS36 0.00022 46 23 6 205 3 mnmE tRNA modification GTPase MnmE Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q8CX54 0.000222 45 25 7 170 3 mnmE tRNA modification GTPase MnmE Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q603B5 0.000224 45 23 4 192 3 der GTPase Der Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q1WVH7 0.000225 45 22 2 129 3 mnmE tRNA modification GTPase MnmE Ligilactobacillus salivarius (strain UCC118)
B1YGA8 0.000226 45 27 1 104 3 mnmE tRNA modification GTPase MnmE Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)
O81004 0.00023 45 24 5 188 2 EMB2001 GTP-binding protein At2g22870 Arabidopsis thaliana
Q1IEH7 0.000232 45 23 2 126 3 der GTPase Der Pseudomonas entomophila (strain L48)
B6YQB9 0.000243 45 26 5 131 3 der GTPase Der Azobacteroides pseudotrichonymphae genomovar. CFP2
B2J1L2 0.000246 45 24 4 148 3 der GTPase Der Nostoc punctiforme (strain ATCC 29133 / PCC 73102)
A0LJ92 0.00025 45 22 6 188 3 der GTPase Der Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)
A8AXP0 0.000253 45 25 4 143 3 mnmE tRNA modification GTPase MnmE Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)
A1VER5 0.000255 45 27 2 122 3 mnmE tRNA modification GTPase MnmE Nitratidesulfovibrio vulgaris (strain DP4)
Q72D51 0.000262 45 27 2 122 3 mnmE tRNA modification GTPase MnmE Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
Q92BP8 0.000264 45 24 3 125 3 era GTPase Era Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
O15439 0.000268 46 47 1 46 1 ABCC4 ATP-binding cassette sub-family C member 4 Homo sapiens
A7I145 0.000269 45 27 2 106 3 mnmE tRNA modification GTPase MnmE Campylobacter hominis (strain ATCC BAA-381 / DSM 21671 / CCUG 45161 / LMG 19568 / NCTC 13146 / CH001A)
Q1Q7V4 0.00027 45 28 3 125 3 mnmE tRNA modification GTPase MnmE Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
B2V3Z1 0.000274 45 23 6 201 3 der GTPase Der Clostridium botulinum (strain Alaska E43 / Type E3)
C1D094 0.000275 45 37 0 56 3 der GTPase Der Deinococcus deserti (strain DSM 17065 / CIP 109153 / LMG 22923 / VCD115)
A7ZAW1 0.000277 45 24 2 133 3 mnmE tRNA modification GTPase MnmE Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
A6LEP5 0.000278 45 27 6 150 3 der GTPase Der Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)
C1CSX0 0.00028 45 26 2 109 3 der GTPase Der Streptococcus pneumoniae (strain Taiwan19F-14)
C1CSX0 0.000476 45 24 6 183 3 der GTPase Der Streptococcus pneumoniae (strain Taiwan19F-14)
C1CM45 0.00028 45 26 2 109 3 der GTPase Der Streptococcus pneumoniae (strain P1031)
C1CM45 0.000476 45 24 6 183 3 der GTPase Der Streptococcus pneumoniae (strain P1031)
C1CFT0 0.00028 45 26 2 109 3 der GTPase Der Streptococcus pneumoniae (strain JJA)
C1CFT0 0.000476 45 24 6 183 3 der GTPase Der Streptococcus pneumoniae (strain JJA)
P64063 0.00028 45 26 2 109 3 der GTPase Der Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P64063 0.000476 45 24 6 183 3 der GTPase Der Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
B2IRW4 0.00028 45 26 2 109 3 der GTPase Der Streptococcus pneumoniae (strain CGSP14)
B2IRW4 0.000476 45 24 6 183 3 der GTPase Der Streptococcus pneumoniae (strain CGSP14)
P64062 0.00028 45 26 2 109 3 der GTPase Der Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
P64062 0.000476 45 24 6 183 3 der GTPase Der Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
B8ZMH4 0.00028 45 26 2 109 3 der GTPase Der Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1)
B8ZMH4 0.000476 45 24 6 183 3 der GTPase Der Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1)
B1I766 0.00028 45 26 2 109 3 der GTPase Der Streptococcus pneumoniae (strain Hungary19A-6)
B1I766 0.000476 45 24 6 183 3 der GTPase Der Streptococcus pneumoniae (strain Hungary19A-6)
C1C8U6 0.00028 45 26 2 109 3 der GTPase Der Streptococcus pneumoniae (strain 70585)
C1C8U6 0.000476 45 24 6 183 3 der GTPase Der Streptococcus pneumoniae (strain 70585)
B5E756 0.00028 45 26 2 109 3 der GTPase Der Streptococcus pneumoniae serotype 19F (strain G54)
B5E756 0.000476 45 24 6 183 3 der GTPase Der Streptococcus pneumoniae serotype 19F (strain G54)
Q04J64 0.00028 45 26 2 109 3 der GTPase Der Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q04J64 0.000476 45 24 6 183 3 der GTPase Der Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
B7IP82 0.00028 45 25 5 130 3 der GTPase Der Bacillus cereus (strain G9842)
Q7MT48 0.000281 45 22 7 205 3 der GTPase Der Porphyromonas gingivalis (strain ATCC BAA-308 / W83)
B2V2K0 0.000281 45 23 2 127 3 era GTPase Era Clostridium botulinum (strain Alaska E43 / Type E3)
A5IXJ1 0.000283 45 25 1 97 3 mnmE tRNA modification GTPase MnmE Mycoplasmopsis agalactiae (strain NCTC 10123 / CIP 59.7 / PG2)
Q5QYB3 0.000285 45 23 2 135 3 der GTPase Der Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
A4VNW7 0.000295 45 24 2 127 3 der GTPase Der Stutzerimonas stutzeri (strain A1501)
Q12AC2 0.000297 45 25 4 140 3 der GTPase Der Polaromonas sp. (strain JS666 / ATCC BAA-500)
B8FLF0 0.0003 44 39 3 76 3 engB Probable GTP-binding protein EngB Desulfatibacillum aliphaticivorans
O69162 0.000301 45 28 3 124 3 era GTPase Era Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q8UGK1 0.000303 45 24 5 193 3 era GTPase Era Agrobacterium fabrum (strain C58 / ATCC 33970)
Q2GKS7 0.000307 44 29 9 193 3 engB Probable GTP-binding protein EngB Anaplasma phagocytophilum (strain HZ)
Q8EUV6 0.000309 45 38 0 57 3 mnmE tRNA modification GTPase MnmE Malacoplasma penetrans (strain HF-2)
Q602M5 0.000311 45 32 1 99 3 mnmE tRNA modification GTPase MnmE Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
B5ZBZ8 0.000313 45 26 4 142 3 era GTPase Era Ureaplasma urealyticum serovar 10 (strain ATCC 33699 / Western)
P25811 0.000314 45 25 3 137 3 mnmE tRNA modification GTPase MnmE Bacillus subtilis (strain 168)
P75210 0.000315 45 31 2 92 3 era GTPase Era Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
Q4A7S3 0.000316 44 34 1 73 3 engB Probable GTP-binding protein EngB Mesomycoplasma hyopneumoniae (strain 7448)
A3DE77 0.000325 45 25 8 207 3 der GTPase Der Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
Q8DY73 0.000327 45 25 2 109 3 der GTPase Der Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q3JZR6 0.000327 45 25 2 109 3 der GTPase Der Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q98RJ5 0.000332 45 22 5 169 3 mnmE tRNA modification GTPase MnmE Mycoplasmopsis pulmonis (strain UAB CTIP)
A8EXG4 0.000332 44 27 7 154 3 engB Probable GTP-binding protein EngB Rickettsia canadensis (strain McKiel)
B2GC35 0.000333 45 27 10 188 3 der GTPase Der Limosilactobacillus fermentum (strain NBRC 3956 / LMG 18251)
Q3AEZ3 0.000337 45 22 5 185 3 era GTPase Era Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
Q03F63 0.00034 45 21 5 191 3 era GTPase Era Pediococcus pentosaceus (strain ATCC 25745 / CCUG 21536 / LMG 10740 / 183-1w)
A5N451 0.000341 45 22 3 136 3 mnmE tRNA modification GTPase MnmE Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680)
Q2N6I9 0.000346 45 33 4 103 3 mnmE tRNA modification GTPase MnmE Erythrobacter litoralis (strain HTCC2594)
B8G2P9 0.000347 45 24 6 204 3 der GTPase Der Desulfitobacterium hafniense (strain DSM 10664 / DCB-2)
Q48TS5 0.000353 45 25 4 148 3 mnmE tRNA modification GTPase MnmE Streptococcus pyogenes serotype M28 (strain MGAS6180)
Q1JLX3 0.000353 45 25 4 148 3 mnmE tRNA modification GTPase MnmE Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q600K7 0.000356 44 34 1 73 3 engB Probable GTP-binding protein EngB Mesomycoplasma hyopneumoniae (strain 232)
Q3AG56 0.000357 45 24 3 137 3 mnmE tRNA modification GTPase MnmE Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
P32559 0.000357 45 24 8 232 1 MSS1 tRNA modification GTPase MSS1, mitochondrial Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q9PPZ9 0.000358 45 24 3 145 3 era GTPase Era Ureaplasma parvum serovar 3 (strain ATCC 700970)
B1AJD1 0.000358 45 24 3 145 3 era GTPase Era Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736)
A9VMB3 0.000367 45 25 5 127 3 der GTPase Der Bacillus mycoides (strain KBAB4)
Q24VA2 0.000369 45 24 6 204 3 der GTPase Der Desulfitobacterium hafniense (strain Y51)
A6UEE9 0.000372 45 27 1 94 3 mnmE tRNA modification GTPase MnmE Sinorhizobium medicae (strain WSM419)
B9LBT6 0.000372 45 21 6 234 3 der GTPase Der Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl)
A9WHH9 0.000372 45 21 6 234 3 der GTPase Der Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl)
Q1J6U1 0.000376 45 25 4 148 3 mnmE tRNA modification GTPase MnmE Streptococcus pyogenes serotype M4 (strain MGAS10750)
B4S596 0.000377 44 28 4 132 3 engB Probable GTP-binding protein EngB Prosthecochloris aestuarii (strain DSM 271 / SK 413)
A0PX77 0.000379 45 24 4 146 3 mnmE tRNA modification GTPase MnmE Clostridium novyi (strain NT)
Q833M8 0.000384 44 25 6 159 3 engB Probable GTP-binding protein EngB Enterococcus faecalis (strain ATCC 700802 / V583)
Q8KAK5 0.000388 44 31 8 149 3 engB Probable GTP-binding protein EngB Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
A6TM67 0.000388 44 28 5 131 3 engB Probable GTP-binding protein EngB Alkaliphilus metalliredigens (strain QYMF)
A0AIR3 0.00039 45 24 3 125 3 era GTPase Era Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
A8EV95 0.000391 45 24 3 122 3 mnmE tRNA modification GTPase MnmE Aliarcobacter butzleri (strain RM4018)
C6C0G0 0.000393 45 41 0 56 3 der GTPase Der Maridesulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIMB 8403 / VKM B-1763)
Q9KCD4 0.000398 45 24 7 192 3 der GTPase Der Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
A7FPC2 0.000398 45 28 3 128 3 mnmE tRNA modification GTPase MnmE Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q9RS19 0.00041 45 35 0 56 3 der GTPase Der Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
Q725L9 0.000412 45 42 0 54 3 der GTPase Der Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
Q1JH22 0.000414 45 26 4 138 3 mnmE tRNA modification GTPase MnmE Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q8P161 0.000414 45 26 4 138 3 mnmE tRNA modification GTPase MnmE Streptococcus pyogenes serotype M18 (strain MGAS8232)
C0QLA5 0.000418 43 25 6 167 3 engB Probable GTP-binding protein EngB Desulforapulum autotrophicum (strain ATCC 43914 / DSM 3382 / VKM B-1955 / HRM2)
P0DG23 0.000418 45 26 4 138 3 mnmE tRNA modification GTPase MnmE Streptococcus pyogenes serotype M3 (strain SSI-1)
P0DG22 0.000418 45 26 4 138 3 mnmE tRNA modification GTPase MnmE Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
Q99ZU0 0.000422 45 26 4 138 3 mnmE tRNA modification GTPase MnmE Streptococcus pyogenes serotype M1
A2REM7 0.000426 45 26 4 138 3 mnmE tRNA modification GTPase MnmE Streptococcus pyogenes serotype M5 (strain Manfredo)
Q3B6D1 0.000427 44 30 5 131 3 engB Probable GTP-binding protein EngB Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530)
Q3B1B4 0.000432 45 25 3 134 3 mnmE tRNA modification GTPase MnmE Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530)
A1V9V1 0.00044 45 42 0 54 3 der GTPase Der Nitratidesulfovibrio vulgaris (strain DP4)
A0AMD2 0.000453 45 24 3 130 3 mnmE tRNA modification GTPase MnmE Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
Q92KW1 0.000465 45 28 1 96 3 mnmE tRNA modification GTPase MnmE Rhizobium meliloti (strain 1021)
A8F6R1 0.000469 44 29 4 124 3 era GTPase Era Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO)
B8DE49 0.000472 44 25 3 128 3 era GTPase Era Listeria monocytogenes serotype 4a (strain HCC23)
Q8R9J1 0.000477 45 23 6 189 3 der GTPase Der Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q6HL51 0.000484 45 25 5 130 3 der GTPase Der Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q63DM8 0.000484 45 25 5 130 3 der GTPase Der Bacillus cereus (strain ZK / E33L)
Q81FR5 0.000484 45 25 5 130 3 der GTPase Der Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
B9IVM6 0.000484 45 25 5 130 3 der GTPase Der Bacillus cereus (strain Q1)
B7HL14 0.000484 45 25 5 130 3 der GTPase Der Bacillus cereus (strain AH187)
B7HHQ7 0.000484 45 25 5 130 3 der GTPase Der Bacillus cereus (strain B4264)
C1EN01 0.000484 45 25 5 130 3 der GTPase Der Bacillus cereus (strain 03BB102)
Q73AZ1 0.000484 45 25 5 130 3 der GTPase Der Bacillus cereus (strain ATCC 10987 / NRS 248)
B7JGY9 0.000484 45 25 5 130 3 der GTPase Der Bacillus cereus (strain AH820)
Q81SW9 0.000484 45 25 5 130 3 der GTPase Der Bacillus anthracis
A0RBV9 0.000484 45 25 5 130 3 der GTPase Der Bacillus thuringiensis (strain Al Hakam)
C3L9F4 0.000484 45 25 5 130 3 der GTPase Der Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3P591 0.000484 45 25 5 130 3 der GTPase Der Bacillus anthracis (strain A0248)
A8FEL8 0.000489 45 25 6 187 3 der GTPase Der Bacillus pumilus (strain SAFR-032)
B9DTQ3 0.000493 45 24 2 109 3 der GTPase Der Streptococcus uberis (strain ATCC BAA-854 / 0140J)
B2TMB9 0.000494 44 23 2 127 3 era GTPase Era Clostridium botulinum (strain Eklund 17B / Type B)
Q8Y750 0.000494 44 25 3 128 3 era GTPase Era Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q71ZK8 0.000494 44 25 3 128 3 era GTPase Era Listeria monocytogenes serotype 4b (strain F2365)
C1KVA9 0.000494 44 25 3 128 3 era GTPase Era Listeria monocytogenes serotype 4b (strain CLIP80459)
Q926U7 0.000495 45 24 3 130 3 mnmE tRNA modification GTPase MnmE Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q71VV0 0.000504 45 24 3 130 3 mnmE tRNA modification GTPase MnmE Listeria monocytogenes serotype 4b (strain F2365)
A8GPN6 0.000507 45 24 2 138 3 mnmE tRNA modification GTPase MnmE Rickettsia akari (strain Hartford)
Q8Y3M4 0.000509 45 24 3 130 3 mnmE tRNA modification GTPase MnmE Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
P75303 0.000519 43 25 7 195 3 engB Probable GTP-binding protein EngB Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
A5IC36 0.000544 44 26 2 123 3 der GTPase Der Legionella pneumophila (strain Corby)
Q5X522 0.000544 44 26 2 123 3 der GTPase Der Legionella pneumophila (strain Paris)
Q1QTK4 0.000552 44 21 6 205 3 der GTPase Der Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q9CHH6 0.000559 44 25 9 183 3 der GTPase Der Lactococcus lactis subsp. lactis (strain IL1403)
A5FIR0 0.00056 44 23 4 146 3 der GTPase Der Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / JCM 8514 / BCRC 14874 / CCUG 350202 / NBRC 14942 / NCIMB 11054 / UW101)
Q033L0 0.000564 44 23 2 130 3 mnmE tRNA modification GTPase MnmE Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
A6LRP9 0.000581 44 22 6 186 3 era GTPase Era Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
Q48LZ0 0.00061 44 24 2 126 3 der GTPase Der Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
B1XKC3 0.00061 44 24 3 149 3 mnmE tRNA modification GTPase MnmE Picosynechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)
Q92A71 0.000612 44 23 5 179 3 der GTPase Der Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q4ZX19 0.000615 44 24 2 126 3 der GTPase Der Pseudomonas syringae pv. syringae (strain B728a)
O84704 0.000617 44 31 1 88 3 mnmE tRNA modification GTPase MnmE Chlamydia trachomatis serovar D (strain ATCC VR-885 / DSM 19411 / UW-3/Cx)
B0BAF3 0.000617 44 31 1 88 3 mnmE tRNA modification GTPase MnmE Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis)
B0B8S4 0.000617 44 31 1 88 3 mnmE tRNA modification GTPase MnmE Chlamydia trachomatis serovar L2 (strain ATCC VR-902B / DSM 19102 / 434/Bu)
B7NR09 0.000623 44 25 3 139 3 mnmE tRNA modification GTPase MnmE Escherichia coli O7:K1 (strain IAI39 / ExPEC)
Q5XCB7 0.000625 44 26 4 138 3 mnmE tRNA modification GTPase MnmE Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
Q5WAG3 0.000625 44 26 1 108 3 mnmE tRNA modification GTPase MnmE Shouchella clausii (strain KSM-K16)
Q886Y6 0.000632 44 24 2 126 3 der GTPase Der Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q3KKZ6 0.000639 44 31 1 88 3 mnmE tRNA modification GTPase MnmE Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13)
Q39ZT0 0.000641 44 26 3 119 3 mnmE tRNA modification GTPase MnmE Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
A4SCU1 0.000649 43 30 5 131 3 engB Probable GTP-binding protein EngB Chlorobium phaeovibrioides (strain DSM 265 / 1930)
Q8Y5W8 0.000651 44 23 5 179 3 der GTPase Der Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
B8DBY9 0.000651 44 23 5 179 3 der GTPase Der Listeria monocytogenes serotype 4a (strain HCC23)
Q71Y78 0.000651 44 23 5 179 3 der GTPase Der Listeria monocytogenes serotype 4b (strain F2365)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS17345
Feature type CDS
Gene -
Product 50S ribosome-binding GTPase
Location 3808777 - 3809640 (strand: 1)
Length 864 (nucleotides) / 287 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_232
Orthogroup size 8
N. genomes 7

Actions

Genomic region

Domains

PF01926 50S ribosome-binding GTPase

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3596 General function prediction only (R) R Predicted GTPase

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K06946 uncharacterized protein - -

Protein Sequence

MNKLENHFLFLPKGAKDVFLSHLNKLINYSPTIGLMGKTGAGKSSLINALFQSTLSPVSDVSGCTRQAQRFSMVMNNHTLTFVDLPGVGESLERDREYHQLYRNLLPELDLIIWVLKADDRAWSSDEQCYRFLTKQCGYQSERFLFVLNQADKIEPCRQWDELYHQPSREQVANLELKQQAVITAFKPHHPVMTVSAAEGFQLTELAEQLIQALPAKASSGVARQLNNTYRTQSVEDSACNNFGQCVSDIVDTIINIIPLPPLIKHTISTVKNSIVSVAKSLWSLFF

Flanking regions ( +/- flanking 50bp)

TTCAAATATATATCATCTATGCGAACTTAACATATATTAAGGTTGCAACGATGAATAAACTCGAAAATCATTTTCTTTTCCTCCCTAAAGGGGCTAAGGATGTGTTTTTATCCCATTTGAATAAACTCATCAACTACTCCCCCACCATCGGCCTGATGGGTAAAACCGGAGCAGGAAAATCCAGCCTTATCAACGCTCTATTCCAATCAACCCTATCACCTGTGAGTGATGTATCCGGCTGCACACGCCAAGCTCAACGCTTCAGTATGGTGATGAACAACCATACACTCACCTTTGTTGATTTACCCGGTGTGGGAGAAAGCCTTGAGCGAGATAGAGAATACCACCAGCTCTACCGTAACTTATTGCCAGAACTGGATTTAATCATCTGGGTACTCAAAGCCGATGATAGGGCATGGTCTTCTGATGAACAATGTTATCGCTTTCTCACTAAGCAATGTGGTTATCAATCTGAACGATTTCTGTTTGTATTGAACCAAGCTGACAAAATAGAGCCCTGTCGCCAGTGGGATGAACTGTACCACCAACCATCCCGTGAACAAGTTGCTAACTTAGAATTAAAGCAACAAGCTGTGATAACAGCATTTAAACCGCATCATCCAGTGATGACGGTTTCTGCGGCAGAAGGTTTTCAGCTCACTGAATTAGCAGAGCAATTAATACAGGCGTTACCGGCGAAAGCCAGTAGCGGTGTGGCTAGGCAACTGAATAACACTTATCGGACACAATCCGTGGAAGACTCCGCATGTAACAATTTTGGGCAATGTGTTAGTGATATCGTCGATACCATAATCAATATCATTCCATTACCCCCATTGATAAAACATACGATCAGCACTGTCAAAAACAGCATCGTTTCCGTCGCTAAATCCCTGTGGAGCCTATTCTTTTAACCTCCTACGTTAATTAATTATTCATCACTCTCAGCGCCAGTCCTTAACGG