Homologs in group_1936

Help

6 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_14525 FBDBKF_14525 75.7 Morganella morganii S1 alpA AlpA family phage regulatory protein
FBDBKF_16620 FBDBKF_16620 73.9 Morganella morganii S1 alpA AlpA family transcriptional regulator
EHELCC_07755 EHELCC_07755 75.7 Morganella morganii S2 alpA AlpA family phage regulatory protein
NLDBIP_08080 NLDBIP_08080 75.7 Morganella morganii S4 alpA AlpA family phage regulatory protein
LHKJJB_06185 LHKJJB_06185 75.7 Morganella morganii S3 alpA AlpA family phage regulatory protein
HKOGLL_04730 HKOGLL_04730 75.7 Morganella morganii S5 alpA AlpA family phage regulatory protein

Distribution of the homologs in the orthogroup group_1936

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1936

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P12552 2.29e-05 41 34 2 66 4 None Uncharacterized protein ORF88 Enterobacteria phage P4

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS17330
Feature type CDS
Gene -
Product AlpA family transcriptional regulator
Location 3806544 - 3806774 (strand: -1)
Length 231 (nucleotides) / 76 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_1936
Orthogroup size 7
N. genomes 6

Actions

Genomic region

Domains

PF05930 Prophage CP4-57 regulatory protein (AlpA)

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3311 Transcription (K)
Mobilome: prophages, transposons (X)		 KX DNA-binding transcriptional regulator AlpA

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K07733 prophage regulatory protein - -

Protein Sequence

MSTQAIPLLDDQCVDMKFITRLTGLTDKWFYKLIQDGEFPKPIKLGRSSRWLKSEVENWLQAHIDESRGANSTLES

Flanking regions ( +/- flanking 50bp)

ATTTATCGATATCCCTTCTGCCTTTTAACTTTAAAGACAGGAGTTCAATAATGAGCACTCAAGCGATTCCCTTATTAGATGACCAATGCGTTGATATGAAATTTATAACCCGTTTAACCGGACTAACAGATAAATGGTTTTATAAATTGATCCAAGATGGAGAGTTTCCTAAACCAATAAAACTAGGGCGTAGCTCTCGCTGGTTAAAGAGCGAGGTTGAAAATTGGCTACAGGCACATATTGATGAATCGAGAGGGGCTAACTCAACCCTTGAATCCTAAGATACTATCGCGAATAGTAGTTCATTTTCCACAGTATGATGTTGAACACT