Homologs in group_2949

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_14525 FBDBKF_14525 100.0 Morganella morganii S1 alpA AlpA family phage regulatory protein
EHELCC_07755 EHELCC_07755 100.0 Morganella morganii S2 alpA AlpA family phage regulatory protein
NLDBIP_08080 NLDBIP_08080 100.0 Morganella morganii S4 alpA AlpA family phage regulatory protein
LHKJJB_06185 LHKJJB_06185 100.0 Morganella morganii S3 alpA AlpA family phage regulatory protein
PMI_RS17330 PMI_RS17330 75.7 Proteus mirabilis HI4320 - AlpA family transcriptional regulator

Distribution of the homologs in the orthogroup group_2949

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2949

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P12552 4.86e-06 43 28 1 67 4 None Uncharacterized protein ORF88 Enterobacteria phage P4

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_04730
Feature type CDS
Gene alpA
Product AlpA family phage regulatory protein
Location 1863 - 2084 (strand: 1)
Length 222 (nucleotides) / 73 (amino acids)
In genomic island -

Contig

Accession ZDB_682
Length 259781 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2949
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF05930 Prophage CP4-57 regulatory protein (AlpA)

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3311 Transcription (K)
Mobilome: prophages, transposons (X)
KX DNA-binding transcriptional regulator AlpA

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K07733 prophage regulatory protein - -

Protein Sequence

MMIKTIPATNLLNDQFVDMKFITRFTGLTDKWFYKQIQSGKFPKPIKLGSCSRWLKSEVESWLQARITASRGE

Flanking regions ( +/- flanking 50bp)

ATGACACACCGCAGTCGCCTTCTCCTTTTCATGTTTACAGGAGAAAGACAATGATGATTAAGACTATTCCCGCAACCAACCTGCTGAATGACCAATTTGTTGATATGAAATTCATCACACGGTTTACCGGCTTAACCGACAAATGGTTCTACAAACAGATACAGAGCGGGAAATTTCCCAAGCCGATTAAATTGGGCAGTTGCTCTCGCTGGTTAAAAAGCGAAGTGGAATCATGGCTACAGGCTCGTATTACTGCATCACGAGGAGAGTAACCATGACGGAGTAGCTTCGCTGAAGCTGATGTAGCTCGTCACCGGTACCC