Homologs in group_307

Help

7 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_08715 FBDBKF_08715 75.4 Morganella morganii S1 btsR two-component system response regulator BtsR
EHELCC_12810 EHELCC_12810 75.4 Morganella morganii S2 btsR two-component system response regulator BtsR
NLDBIP_13150 NLDBIP_13150 75.4 Morganella morganii S4 btsR two-component system response regulator BtsR
LHKJJB_13405 LHKJJB_13405 75.4 Morganella morganii S3 btsR two-component system response regulator BtsR
HKOGLL_11625 HKOGLL_11625 75.4 Morganella morganii S5 btsR two-component system response regulator BtsR
F4V73_RS09935 F4V73_RS09935 75.9 Morganella psychrotolerans btsR two-component system response regulator BtsR
PMI_RS17080 PMI_RS17080 76.5 Proteus mirabilis HI4320 - hypothetical protein

Distribution of the homologs in the orthogroup group_307

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_307

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q8ZNN2 3.78e-125 357 70 1 238 3 btsR Transcriptional regulatory protein BtsR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8Z5C1 2.13e-124 355 70 1 238 3 btsR Transcriptional regulatory protein BtsR Salmonella typhi
P0AFT5 2.99e-124 355 69 1 238 1 btsR Transcriptional regulatory protein BtsR Escherichia coli (strain K12)
P0AFT6 2.99e-124 355 69 1 238 3 btsR Transcriptional regulatory protein BtsR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0DUE6 2.99e-124 355 69 1 238 3 btsR Transcriptional regulatory protein BtsR Escherichia coli O157:H7
P0DUE7 2.99e-124 355 69 1 238 4 btsR Transcriptional regulatory protein-like BtsR Enterobacteria phage VT1-Sakai
P59640 3.31e-124 355 69 1 238 3 btsR Transcriptional regulatory protein BtsR Shigella flexneri
Q8ZBV2 5.64e-92 273 57 3 239 3 YPO3287 Uncharacterized response regulatory protein YPO3287/y0902/YP_0397 Yersinia pestis
Q9KU36 7.13e-86 257 55 3 238 3 VC_0693 Uncharacterized response regulatory protein VC_0693 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q8DET1 2.46e-81 246 50 3 242 3 VV1_0503 Uncharacterized response regulatory protein VV1_0503 Vibrio vulnificus (strain CMCP6)
Q87S86 5.22e-79 240 50 3 242 3 VP0538 Uncharacterized response regulatory protein VP0538 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q8EDD7 2.18e-76 233 49 4 238 3 SO_2823 Uncharacterized response regulatory protein SO_2823 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q81JL3 4.82e-41 143 35 5 245 3 lytT Sensory transduction protein LytT Bacillus anthracis
Q82Z76 1.76e-39 139 32 5 245 4 lytT Sensory transduction protein LytT Enterococcus faecalis (strain ATCC 700802 / V583)
Q814J1 3.14e-39 139 35 5 245 4 lytT Sensory transduction protein LytT Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
P94514 1.95e-34 126 32 3 237 3 lytT Sensory transduction protein LytT Bacillus subtilis (strain 168)
Q8EQQ3 1.56e-30 116 32 6 245 3 lytT Sensory transduction protein LytT Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q4A010 6.54e-30 115 30 5 263 3 lytR Sensory transduction protein LytR Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q8FFE0 1.57e-29 114 27 5 246 3 ypdB Transcriptional regulatory protein YpdB Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AE41 2.2e-29 113 27 5 245 3 ypdB Transcriptional regulatory protein YpdB Shigella flexneri
P0AE39 2.2e-29 113 27 5 245 1 ypdB Transcriptional regulatory protein YpdB Escherichia coli (strain K12)
P0AE40 2.2e-29 113 27 5 245 3 ypdB Transcriptional regulatory protein YpdB Escherichia coli O157:H7
Q8DVB7 6.07e-29 112 31 6 247 3 lytR Sensory transduction protein LytR Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q8E217 1.02e-27 108 28 5 247 3 lytR Sensory transduction protein LytR Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8E7H3 1.02e-27 108 28 5 247 3 lytR Sensory transduction protein LytR Streptococcus agalactiae serotype III (strain NEM316)
Q8D4U6 1.24e-27 108 29 6 247 3 VV2_1193 Uncharacterized response regulatory protein VV2_1193 Vibrio vulnificus (strain CMCP6)
Q4L8V4 1.39e-27 108 28 7 265 3 lytR Sensory transduction protein LytR Staphylococcus haemolyticus (strain JCSC1435)
P26275 1.84e-27 108 32 7 243 3 algR Positive alginate biosynthesis regulatory protein Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P60610 2.36e-27 108 28 4 247 3 lytR Transcriptional regulatory protein LytR Staphylococcus aureus (strain N315)
P60609 2.36e-27 108 28 4 247 1 lytR Transcriptional regulatory protein LytR Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HJB5 2.36e-27 108 28 4 247 3 lytR Transcriptional regulatory protein LytR Staphylococcus aureus (strain COL)
P60611 2.36e-27 108 28 4 247 1 lytR Transcriptional regulatory protein LytR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FK09 2.36e-27 108 28 4 247 3 lytR Transcriptional regulatory protein LytR Staphylococcus aureus (strain USA300)
Q2YV67 4.05e-27 107 28 4 247 3 lytR Transcriptional regulatory protein LytR Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q8NYH3 9.41e-27 106 27 4 247 3 lytR Transcriptional regulatory protein LytR Staphylococcus aureus (strain MW2)
Q6GCL1 9.41e-27 106 27 4 247 3 lytR Transcriptional regulatory protein LytR Staphylococcus aureus (strain MSSA476)
Q9KL96 2.08e-26 105 30 8 246 3 VC_A0850 Uncharacterized response regulatory protein VC_A0850 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q6GK51 3.13e-26 105 27 4 247 3 lytR Transcriptional regulatory protein LytR Staphylococcus aureus (strain MRSA252)
Q8CN55 3.19e-25 102 30 5 252 3 lytR Sensory transduction protein LytR Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HLG2 9.6e-25 101 30 5 252 3 lytR Sensory transduction protein LytR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q87K77 1.66e-23 98 29 8 248 3 VPA0021 Uncharacterized response regulatory protein VPA0021 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
P21649 8.47e-22 94 30 3 169 1 mrkE Protein MrkE Klebsiella pneumoniae
P96686 6.77e-14 71 34 1 118 3 ydfI Transcriptional regulatory protein YdfI Bacillus subtilis (strain 168)
P70955 1.81e-13 70 24 6 206 1 natR Transcriptional regulatory protein NatR Bacillus subtilis (strain 168)
Q5JF95 2.16e-13 72 34 1 105 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
P55184 5.49e-13 68 31 2 120 3 yxjL Uncharacterized transcriptional regulatory protein YxjL Bacillus subtilis (strain 168)
Q2SFK0 8.09e-13 70 39 2 106 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Hahella chejuensis (strain KCTC 2396)
Q2IQS6 1.41e-12 69 28 3 183 3 cheB5 Protein-glutamate methylesterase/protein-glutamine glutaminase 5 Anaeromyxobacter dehalogenans (strain 2CP-C)
O07528 2.05e-12 67 33 2 113 3 yhcZ Uncharacterized transcriptional regulatory protein YhcZ Bacillus subtilis (strain 168)
Q12YX1 3.86e-12 68 29 3 130 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M)
O32197 5.81e-12 66 26 6 220 2 liaR Transcriptional regulatory protein LiaR Bacillus subtilis (strain 168)
Q888V8 6.11e-12 67 27 2 132 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q167K9 6.8e-12 67 34 1 106 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
P94439 9.11e-12 65 29 3 132 1 lnrK Transcriptional regulatory protein LnrK Bacillus subtilis (strain 168)
Q9UYF3 9.64e-12 67 30 1 105 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Pyrococcus abyssi (strain GE5 / Orsay)
P0A4H5 1.15e-11 63 27 2 116 3 cheY Chemotaxis protein CheY Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
P0A4H6 1.15e-11 63 27 2 116 3 cheY Chemotaxis protein CheY Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q4ZYD3 2.65e-11 65 29 1 105 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Pseudomonas syringae pv. syringae (strain B728a)
P13800 3.36e-11 64 30 1 120 1 degU Transcriptional regulatory protein DegU Bacillus subtilis (strain 168)
O58192 3.74e-11 65 29 1 105 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Q0AXB7 3.92e-11 65 33 0 101 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
Q48ND9 5.35e-11 65 28 1 105 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q6AJV3 1.16e-10 63 35 2 113 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Desulfotalea psychrophila (strain LSv54 / DSM 12343)
O85128 1.18e-10 63 33 2 104 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Agrobacterium fabrum (strain C58 / ATCC 33970)
A1SMR4 1.36e-10 63 28 2 132 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Nocardioides sp. (strain ATCC BAA-499 / JS614)
P43501 1.39e-10 60 32 3 120 3 pilH Protein PilH Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9KT84 2.08e-10 63 31 7 149 1 luxO Regulatory protein LuxO Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q2FMT2 2.56e-10 62 33 2 106 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1)
Q1IRH0 2.72e-10 62 38 2 104 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Koribacter versatilis (strain Ellin345)
P9WGM3 2.81e-10 61 37 4 105 1 pdtaR Transcriptional regulatory protein PdtaR Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM2 2.81e-10 61 37 4 105 3 pdtaR Transcriptional regulatory protein PdtaR Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q56312 2.81e-10 59 26 2 117 1 cheY Chemotaxis protein CheY Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
O87717 3.33e-10 62 31 3 130 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q2KCH8 3.43e-10 62 34 2 104 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q0AYL3 3.76e-10 62 29 2 107 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
Q8TLG9 4.05e-10 62 30 3 133 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q05522 4.39e-10 62 34 2 105 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Bacillus subtilis (strain 168)
P52941 4.51e-10 61 35 2 123 3 spo0A Stage 0 sporulation protein A homolog Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
Q24T61 4.83e-10 62 30 1 105 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Desulfitobacterium hafniense (strain Y51)
Q2W2W9 6.14e-10 62 33 1 103 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
P62645 6.45e-10 61 30 2 126 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase of group 3 operon Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q5QZQ3 7.41e-10 61 31 2 107 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q52883 7.63e-10 61 35 2 104 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase of group 1 operon Rhizobium meliloti (strain 1021)
Q3ADA6 1.07e-09 61 37 4 108 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
Q7A7X9 1.23e-09 60 30 5 121 1 hptR Transcriptional regulatory protein HptR Staphylococcus aureus (strain N315)
Q99X00 1.23e-09 60 30 5 121 3 hptR Transcriptional regulatory protein HptR Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q1IQS9 1.53e-09 60 27 1 111 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Koribacter versatilis (strain Ellin345)
Q46DT6 1.64e-09 60 35 1 102 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Methanosarcina barkeri (strain Fusaro / DSM 804)
Q89SQ1 1.87e-09 60 31 3 126 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase of group 3 operon Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q7NSI8 2.21e-09 60 31 5 150 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q1MLG8 2.33e-09 60 28 3 139 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q7NV40 2.34e-09 60 31 2 110 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q8TUQ0 2.52e-09 60 33 1 102 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q1D359 2.84e-09 59 27 1 103 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Myxococcus xanthus (strain DK1622)
P44845 2.87e-09 58 27 1 120 3 narP Nitrate/nitrite response regulator protein homolog Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q9WYN9 3.06e-09 59 25 1 105 1 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
P52929 3.37e-09 58 34 5 124 3 spo0A Stage 0 sporulation protein A (Fragment) Brevibacillus parabrevis
Q5L0L0 3.47e-09 59 31 1 105 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Geobacillus kaustophilus (strain HTA426)
Q3ADG9 3.68e-09 59 33 1 103 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
Q6GK93 3.71e-09 58 30 5 121 3 hptR Transcriptional regulatory protein HptR Staphylococcus aureus (strain MRSA252)
Q8NYJ9 3.75e-09 58 30 5 121 3 hptR Transcriptional regulatory protein HptR Staphylococcus aureus (strain MW2)
Q6GCQ3 3.75e-09 58 30 5 121 3 hptR Transcriptional regulatory protein HptR Staphylococcus aureus (strain MSSA476)
Q5HJF7 3.75e-09 58 30 5 121 2 hptR Transcriptional regulatory protein HptR Staphylococcus aureus (strain COL)
Q2G1E1 3.75e-09 58 30 5 121 1 hptR Transcriptional regulatory protein HptR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FK47 3.75e-09 58 30 5 121 3 hptR Transcriptional regulatory protein HptR Staphylococcus aureus (strain USA300)
Q2YV56 3.9e-09 58 30 5 121 3 hptR Transcriptional regulatory protein HptR Staphylococcus aureus (strain bovine RF122 / ET3-1)
A0QTK2 5.05e-09 58 34 3 104 1 mtrA DNA-binding response regulator MtrA Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
P39486 5.79e-09 58 25 2 117 3 dctR Probable C4-dicarboxylate response regulator DctR Priestia megaterium
O34723 6.33e-09 57 29 2 121 1 desR Transcriptional regulatory protein DesR Bacillus subtilis (strain 168)
P54662 6.33e-09 58 25 1 120 3 degU Transcriptional regulatory protein DegU Brevibacillus brevis
Q44006 7.02e-09 57 28 4 135 2 czcR Transcriptional activator protein CzcR Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q30RX5 7.42e-09 58 30 1 105 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251)
P35163 7.98e-09 57 37 2 102 1 resD Transcriptional regulatory protein ResD Bacillus subtilis (strain 168)
Q8EEQ0 8.38e-09 58 28 3 132 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q2ILG8 9.07e-09 58 30 1 103 3 cheB6 Protein-glutamate methylesterase/protein-glutamine glutaminase 6 Anaeromyxobacter dehalogenans (strain 2CP-C)
Q31HL9 1.03e-08 58 29 1 105 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
P52934 1.05e-08 57 34 5 116 1 spo0A Stage 0 sporulation protein A Geobacillus stearothermophilus
Q15RF6 1.09e-08 58 28 5 173 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q1MP86 1.13e-08 58 27 1 102 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Lawsonia intracellularis (strain PHE/MN1-00)
Q8EQW0 1.21e-08 58 27 1 102 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q97GZ3 1.21e-08 58 29 3 130 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q311M8 1.23e-08 58 31 2 111 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
Q1MC14 1.32e-08 57 33 2 105 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q8PX96 1.41e-08 57 35 1 102 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q2RUI8 1.45e-08 57 30 1 105 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q20YL8 1.46e-08 57 27 1 106 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Rhodopseudomonas palustris (strain BisB18)
P62636 1.49e-08 57 33 2 103 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
Q7A0I0 1.72e-08 56 25 2 120 3 vraR Response regulator protein VraR Staphylococcus aureus (strain MW2)
Q6G850 1.72e-08 56 25 2 120 3 vraR Response regulator protein VraR Staphylococcus aureus (strain MSSA476)
Q6GFH3 1.72e-08 56 25 2 120 3 vraR Response regulator protein VraR Staphylococcus aureus (strain MRSA252)
Q7A4R9 1.72e-08 56 25 2 120 1 vraR Response regulator protein VraR Staphylococcus aureus (strain N315)
Q7A2Q1 1.72e-08 56 25 2 120 1 vraR Response regulator protein VraR Staphylococcus aureus (strain Mu50 / ATCC 700699)
P0C0Z1 1.72e-08 56 25 2 120 3 vraR Response regulator protein VraR Staphylococcus aureus (strain Mu3 / ATCC 700698)
P24908 1.76e-08 56 42 1 66 1 PA0034 Putative transcriptional regulator Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P62637 1.8e-08 57 30 2 111 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
P52932 1.81e-08 56 30 3 126 3 spo0A Stage 0 sporulation protein A (Fragment) Priestia megaterium
Q1QI44 1.83e-08 57 26 1 115 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
Q2YC79 1.91e-08 57 29 1 106 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
P45709 1.93e-08 54 30 4 117 3 ccdB Protein CcdB Bacillus subtilis (strain 168)
Q8Q009 2.12e-08 57 32 2 101 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q3BUA2 2.13e-08 57 30 1 105 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q8PLB4 2.13e-08 57 30 1 105 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Xanthomonas axonopodis pv. citri (strain 306)
Q0A9Z5 2.14e-08 57 27 2 104 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q2IT50 2.21e-08 57 27 1 106 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Rhodopseudomonas palustris (strain HaA2)
Q132U2 2.24e-08 57 28 1 106 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Rhodopseudomonas palustris (strain BisB5)
Q06065 2.26e-08 57 33 4 118 1 atoC Regulatory protein AtoC Escherichia coli (strain K12)
Q30ZJ5 2.26e-08 57 28 1 105 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
Q7MBQ5 2.28e-08 57 30 1 105 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Vibrio vulnificus (strain YJ016)
Q3SIG0 2.48e-08 57 32 2 106 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Thiobacillus denitrificans (strain ATCC 25259)
P62644 2.61e-08 57 28 1 106 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase of group 2 operon Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q5GYV8 2.61e-08 57 30 1 105 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
Q2P1V8 2.61e-08 57 30 1 105 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q4UU97 2.71e-08 57 30 1 105 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Xanthomonas campestris pv. campestris (strain 8004)
Q8P9J7 2.71e-08 57 30 1 105 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
P58253 3.02e-08 56 33 2 110 3 spo0A Stage 0 sporulation protein A homolog Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
O78428 3.13e-08 56 33 4 123 3 ycf27 Probable transcriptional regulator ycf27 Guillardia theta
P51586 3.24e-08 54 34 3 108 3 None Uncharacterized 14.6 kDa protein in sodA1 3'region Leptolyngbya boryana
Q10WZ6 3.25e-08 56 29 2 119 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Trichodesmium erythraeum (strain IMS101)
Q2RKH8 3.26e-08 57 28 1 111 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
P52931 3.87e-08 55 32 6 142 3 spo0A Stage 0 sporulation protein A (Fragment) Niallia circulans
P06534 3.95e-08 55 29 3 132 1 spo0A Stage 0 sporulation protein A Bacillus subtilis (strain 168)
Q8RAZ3 4.17e-08 56 31 5 138 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q0AWZ8 4.27e-08 56 28 2 105 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
P52928 4.31e-08 55 30 4 133 3 spo0A Stage 0 sporulation protein A Bacillus anthracis
P62640 4.48e-08 56 28 2 104 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Q04849 4.59e-08 56 33 3 111 3 ntrX Nitrogen assimilation regulatory protein NtrX Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
Q3SVA1 4.82e-08 56 26 1 115 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
Q2SFY4 4.84e-08 56 30 0 88 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Hahella chejuensis (strain KCTC 2396)
Q0HIF6 4.85e-08 56 27 1 105 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Shewanella sp. (strain MR-4)
P0AED6 4.88e-08 55 29 2 122 3 uvrY Response regulator UvrY Shigella flexneri
P0AED5 4.88e-08 55 29 2 122 1 uvrY Response regulator UvrY Escherichia coli (strain K12)
Q0HVI0 5.18e-08 56 27 1 105 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Shewanella sp. (strain MR-7)
Q8EF61 5.27e-08 56 28 1 105 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q9I6V9 5.4e-08 56 30 2 106 1 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P66797 5.54e-08 55 29 2 122 3 uvrY Response regulator UvrY Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P66798 5.54e-08 55 29 2 122 3 uvrY Response regulator UvrY Escherichia coli O157:H7
P24072 6.09e-08 53 26 2 114 1 cheY Chemotaxis protein CheY Bacillus subtilis (strain 168)
P52688 6.27e-08 55 24 7 239 1 citB Transcriptional regulatory protein CitB Klebsiella pneumoniae
P0A4H2 7.07e-08 54 36 1 77 1 bvgA Virulence factors putative positive transcription regulator BvgA Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
P0A4H4 7.07e-08 54 36 1 77 3 bvgA Virulence factors putative positive transcription regulator BvgA Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
P0A4H3 7.07e-08 54 36 1 77 3 bvgA Virulence factors putative positive transcription regulator BvgA Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q8CN75 7.27e-08 54 30 4 123 3 nreC Oxygen regulatory protein NreC Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q9KA55 7.5e-08 55 28 1 105 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q2LR65 7.78e-08 55 31 2 106 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Syntrophus aciditrophicus (strain SB)
O05251 8.2e-08 54 31 4 125 3 malR Transcriptional regulatory protein MalR Bacillus subtilis (strain 168)
Q8D4X6 8.5e-08 55 29 1 105 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Vibrio vulnificus (strain CMCP6)
O31517 9.29e-08 55 31 4 119 3 yesN Uncharacterized transcriptional regulatory protein YesN Bacillus subtilis (strain 168)
P0A4I4 9.4e-08 55 30 3 121 3 spo0A Stage 0 sporulation protein A Bacillus thuringiensis
P0A4I3 9.4e-08 55 30 3 121 3 spo0A Stage 0 sporulation protein A Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q87MX7 9.89e-08 55 25 5 148 3 luxO Regulatory protein LuxO Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
P0C5S5 1.05e-07 55 25 5 148 3 luxO Luminescence regulatory protein LuxO Vibrio harveyi
A7MVC2 1.05e-07 55 25 5 148 1 luxO Luminescence regulatory protein LuxO Vibrio campbellii (strain ATCC BAA-1116)
Q47I43 1.08e-07 55 33 3 104 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Dechloromonas aromatica (strain RCB)
Q9CD68 1.1e-07 54 33 4 118 3 mprA Response regulator MprA Mycobacterium leprae (strain TN)
Q93CB8 1.11e-07 54 32 3 104 3 mtrA DNA-binding response regulator MtrA Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
Q9CCJ2 1.17e-07 54 32 3 104 3 mtrA DNA-binding response regulator MtrA Mycobacterium leprae (strain TN)
Q1GZZ0 1.19e-07 55 30 3 106 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
P9WGM7 1.19e-07 54 32 3 104 1 mtrA DNA-binding response regulator MtrA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM6 1.19e-07 54 32 3 104 3 mtrA DNA-binding response regulator MtrA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0A5Z5 1.19e-07 54 32 3 104 3 mtrA DNA-binding response regulator MtrA Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q7A029 1.24e-07 53 29 4 123 3 nreC Oxygen regulatory protein NreC Staphylococcus aureus (strain MW2)
A8Z580 1.24e-07 53 29 4 123 3 nreC Oxygen regulatory protein NreC Staphylococcus aureus (strain USA300 / TCH1516)
Q6G6T0 1.24e-07 53 29 4 123 3 nreC Oxygen regulatory protein NreC Staphylococcus aureus (strain MSSA476)
Q7A3U5 1.24e-07 53 29 4 123 3 nreC Oxygen regulatory protein NreC Staphylococcus aureus (strain N315)
Q99RN8 1.24e-07 53 29 4 123 3 nreC Oxygen regulatory protein NreC Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QJN1 1.24e-07 53 29 4 123 3 nreC Oxygen regulatory protein NreC Staphylococcus aureus (strain Newman)
Q5HDG5 1.24e-07 53 29 4 123 3 nreC Oxygen regulatory protein NreC Staphylococcus aureus (strain COL)
A5IVH2 1.24e-07 53 29 4 123 3 nreC Oxygen regulatory protein NreC Staphylococcus aureus (strain JH9)
Q2FVM7 1.24e-07 53 29 4 123 3 nreC Oxygen regulatory protein NreC Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FEA6 1.24e-07 53 29 4 123 3 nreC Oxygen regulatory protein NreC Staphylococcus aureus (strain USA300)
A6U4C0 1.24e-07 53 29 4 123 3 nreC Oxygen regulatory protein NreC Staphylococcus aureus (strain JH1)
A7X623 1.24e-07 53 29 4 123 3 nreC Oxygen regulatory protein NreC Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q5HKE0 1.24e-07 54 30 4 120 3 SERP2406 Uncharacterized response regulatory protein SERP2406 Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q39S45 1.24e-07 55 34 2 106 3 cheB4 Protein-glutamate methylesterase/protein-glutamine glutaminase 4 Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
Q5HLK6 1.29e-07 53 29 4 123 3 nreC Oxygen regulatory protein NreC Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
O83639 1.29e-07 55 27 4 143 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Treponema pallidum (strain Nichols)
Q2RZD2 1.31e-07 55 26 2 104 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Salinibacter ruber (strain DSM 13855 / M31)
Q6GE42 1.31e-07 53 29 4 123 3 nreC Oxygen regulatory protein NreC Staphylococcus aureus (strain MRSA252)
Q2YZ42 1.31e-07 53 29 4 123 3 nreC Oxygen regulatory protein NreC Staphylococcus aureus (strain bovine RF122 / ET3-1)
O07019 1.38e-07 53 29 2 122 3 yvfU Uncharacterized transcriptional regulatory protein YvfU Bacillus subtilis (strain 168)
O69730 1.38e-07 54 33 4 109 1 tcrX Probable transcriptional regulatory protein TcrX Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P0AEF7 1.5e-07 53 36 5 125 3 dpiA Transcriptional regulatory protein DpiA Shigella flexneri
P0AEF4 1.5e-07 53 36 5 125 1 dpiA Transcriptional regulatory protein DpiA Escherichia coli (strain K12)
P0AEF5 1.5e-07 53 36 5 125 3 dpiA Transcriptional regulatory protein DpiA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AEF6 1.5e-07 53 36 5 125 3 dpiA Transcriptional regulatory protein DpiA Escherichia coli O157:H7
P96602 1.65e-07 53 27 5 140 3 dctR Probable C4-dicarboxylate response regulator DctR Bacillus subtilis (strain 168)
P9WGM5 1.73e-07 53 26 3 130 1 narL Probable transcriptional regulatory protein NarL Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM4 1.73e-07 53 26 3 130 3 narL Probable transcriptional regulatory protein NarL Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A0R3I8 1.8e-07 53 33 4 118 1 mprA Response regulator MprA Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q2FQU2 1.8e-07 54 40 0 62 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1)
Q742C1 1.94e-07 53 32 4 125 3 mprA Response regulator MprA Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
A0QBQ9 1.94e-07 53 32 4 125 3 mprA Response regulator MprA Mycobacterium avium (strain 104)
P9WMF9 2.25e-07 53 25 1 120 1 devR DNA-binding transcriptional activator DevR/DosR Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WMF8 2.25e-07 53 25 1 120 2 devR DNA-binding transcriptional activator DevR/DosR Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P52940 2.3e-07 53 32 3 121 3 spo0A Stage 0 sporulation protein A homolog Clostridium pasteurianum
Q1B3X8 2.33e-07 53 33 4 118 3 mprA Response regulator MprA Mycobacterium sp. (strain MCS)
A1UL70 2.33e-07 53 33 4 118 3 mprA Response regulator MprA Mycobacterium sp. (strain KMS)
A3Q5L9 2.33e-07 53 33 4 118 3 mprA Response regulator MprA Mycobacterium sp. (strain JLS)
Q3A5A8 2.48e-07 53 26 1 105 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
Q7MM78 2.5e-07 54 27 7 149 3 luxO Regulatory protein LuxO Vibrio vulnificus (strain YJ016)
Q8CWJ5 2.5e-07 54 27 7 149 3 luxO Regulatory protein LuxO Vibrio vulnificus (strain CMCP6)
P0AF31 2.5e-07 53 31 1 129 3 narL Nitrate/nitrite response regulator protein NarL Shigella flexneri
P0AF28 2.5e-07 53 31 1 129 1 narL Nitrate/nitrite response regulator protein NarL Escherichia coli (strain K12)
P0AF29 2.5e-07 53 31 1 129 3 narL Nitrate/nitrite response regulator protein NarL Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AF30 2.5e-07 53 31 1 129 3 narL Nitrate/nitrite response regulator protein NarL Escherichia coli O157:H7
Q1XDC9 2.61e-07 53 31 5 155 3 ycf27 Probable transcriptional regulator ycf27 Neopyropia yezoensis
Q1CX06 2.73e-07 53 32 1 109 3 cheB4 Protein-glutamate methylesterase/protein-glutamine glutaminase 4 Myxococcus xanthus (strain DK1622)
P51358 2.73e-07 53 31 5 155 3 ycf27 Probable transcriptional regulator ycf27 Porphyra purpurea
Q1QVY7 2.86e-07 53 29 2 106 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q6LU34 2.95e-07 53 27 2 102 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Photobacterium profundum (strain SS9)
Q89T55 3.11e-07 53 26 1 106 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase of group 2 operon Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q3J1W3 3.15e-07 53 33 2 103 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
P72781 3.19e-07 53 31 3 112 1 rre1 Response regulator Rre1 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q8CQE3 3.6e-07 53 27 3 119 3 SE_0165 Uncharacterized response regulatory protein SE_0165 Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q8KLS5 3.66e-07 53 32 2 104 1 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase of group 2 operon Cereibacter sphaeroides
Q1LH11 4.18e-07 53 30 2 106 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
P0DMI2 4.28e-07 53 24 4 141 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
B0R4K0 4.28e-07 53 24 4 141 1 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)
O52262 4.81e-07 53 26 3 136 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Pseudomonas putida
Q88EW5 4.96e-07 53 29 2 107 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase of group 1 operon Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q8F3H4 5.21e-07 53 30 1 105 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
P62643 5.21e-07 53 30 1 105 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
Q52376 5.57e-07 52 29 2 103 3 gacA Response regulator GacA Pseudomonas syringae pv. syringae (strain B728a)
Q820K0 5.9e-07 53 32 2 106 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q39SY1 6.14e-07 52 25 3 134 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
Q9HXT8 6.63e-07 52 35 1 99 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P95582 6.82e-07 52 29 2 103 3 gacA Response regulator GacA Pseudomonas viridiflava
Q2T8Y5 7.19e-07 52 31 2 105 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q4KG36 7.36e-07 52 28 2 107 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q221I1 7.36e-07 52 30 2 106 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
P31802 7.72e-07 51 27 1 120 3 narP Nitrate/nitrite response regulator protein NarP Escherichia coli (strain K12)
Q2WAJ8 8.1e-07 52 28 2 113 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
Q67P67 8.14e-07 52 28 1 105 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
Q2RRX2 8.65e-07 52 31 3 104 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
A1KHB7 9.96e-07 51 33 4 118 3 mprA Response regulator MprA Mycobacterium bovis (strain BCG / Pasteur 1173P2)
Q7U0X4 9.96e-07 51 33 4 118 1 mprA Response regulator MprA Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
O29221 1.01e-06 52 28 2 105 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
A0PWB4 1.02e-06 51 33 4 118 3 mprA Response regulator MprA Mycobacterium ulcerans (strain Agy99)
Q2SBX9 1.02e-06 52 29 2 107 3 cheB4 Protein-glutamate methylesterase/protein-glutamine glutaminase 4 Hahella chejuensis (strain KCTC 2396)
P62639 1.07e-06 52 24 2 145 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Q20XE6 1.11e-06 52 32 2 105 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Rhodopseudomonas palustris (strain BisB18)
Q12IZ9 1.13e-06 52 27 1 102 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
P9WGM9 1.23e-06 51 33 4 118 1 mprA Response regulator MprA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM8 1.23e-06 51 33 4 118 3 mprA Response regulator MprA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5U123 1.23e-06 51 33 4 118 3 mprA Response regulator MprA Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
Q7WZY4 1.24e-06 51 25 2 122 1 nreC Oxygen regulatory protein NreC Staphylococcus carnosus (strain TM300)
B0R4K1 1.29e-06 49 31 3 116 1 cheY Chemotaxis protein CheY Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)
P52936 1.29e-06 51 33 3 121 3 spo0A Stage 0 sporulation protein A homolog Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
Q9I4F9 1.31e-06 51 28 3 117 1 phoP Two-component response regulator PhoP Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q1CWZ9 1.36e-06 52 28 2 113 3 cheB5 Protein-glutamate methylesterase/protein-glutamine glutaminase 5 Myxococcus xanthus (strain DK1622)
P0ACZ7 1.43e-06 50 30 1 81 1 evgA DNA-binding transcriptional activator EvgA Shigella flexneri
P0ACZ4 1.43e-06 50 30 1 81 1 evgA DNA-binding transcriptional activator EvgA Escherichia coli (strain K12)
P0ACZ5 1.43e-06 50 30 1 81 3 evgA DNA-binding transcriptional activator EvgA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0ACZ6 1.43e-06 50 30 1 81 3 evgA DNA-binding transcriptional activator EvgA Escherichia coli O157:H7
Q21ZZ9 1.44e-06 51 28 1 102 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Q65JK6 1.45e-06 52 28 2 105 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
O87125 1.46e-06 52 27 3 120 1 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q4L8Q6 1.52e-06 50 27 2 121 3 nreC Oxygen regulatory protein NreC Staphylococcus haemolyticus (strain JCSC1435)
P62638 1.57e-06 51 24 1 104 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Q1M7A0 1.57e-06 50 24 3 122 3 mctR Transcriptional regulatory protein MctR Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
A1TEL7 1.6e-06 51 33 4 118 3 mprA Response regulator MprA Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
Q9K998 1.64e-06 50 25 2 116 3 dctR Probable C4-dicarboxylate response regulator DctR Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q46PH7 1.85e-06 51 29 2 106 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q3KFZ6 1.87e-06 51 28 2 107 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Pseudomonas fluorescens (strain Pf0-1)
P52938 1.9e-06 51 30 2 108 3 spo0A Stage 0 sporulation protein A homolog Clostridioides difficile
Q6LTM2 1.95e-06 51 27 2 107 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Photobacterium profundum (strain SS9)
Q39WQ9 2.06e-06 51 31 2 105 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
P28835 2.09e-06 50 29 6 154 3 ycf27 Probable transcriptional regulator ycf27 Porphyridium aerugineum
Q21IQ9 2.31e-06 51 28 2 103 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
P72253 2.41e-06 51 30 4 118 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase of group 2 operon Rhodospirillum centenum (strain ATCC 51521 / SW)
Q9ZHD3 2.49e-06 50 31 4 122 3 silR Probable transcriptional regulatory protein SilR Salmonella typhimurium
Q8XQ83 2.55e-06 51 27 1 105 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q7MIQ5 2.62e-06 51 25 8 209 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Vibrio vulnificus (strain YJ016)
L7N689 2.88e-06 50 30 7 149 1 trcR Transcriptional regulatory protein TrcR Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Q3IDZ3 2.92e-06 50 26 2 107 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Pseudoalteromonas translucida (strain TAC 125)
P62647 2.96e-06 50 24 1 105 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Methanococcus maripaludis (strain DSM 14266 / JCM 13030 / NBRC 101832 / S2 / LL)
Q51373 3.01e-06 50 22 1 122 3 gacA Response regulator GacA Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q47GX7 3.1e-06 50 29 2 105 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Dechloromonas aromatica (strain RCB)
Q8DB67 3.19e-06 50 28 2 107 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Vibrio vulnificus (strain CMCP6)
Q8DN02 3.4e-06 50 30 3 116 1 rr06 Response regulator RR06 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
A0A0H2ZNF6 3.4e-06 50 30 3 116 1 rr06 Response regulator RR06 Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
P94504 3.78e-06 50 32 3 116 3 yvrH Transcriptional regulatory protein YvrH Bacillus subtilis (strain 168)
Q9KQD8 3.84e-06 50 28 2 107 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q7N5T1 4.02e-06 50 31 2 105 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q2IQ87 4.14e-06 50 25 0 83 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Anaeromyxobacter dehalogenans (strain 2CP-C)
Q4ZQV7 4.15e-06 50 28 2 107 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Pseudomonas syringae pv. syringae (strain B728a)
Q884V3 4.17e-06 50 28 2 107 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q04803 4.46e-06 50 31 3 104 3 pfeR Transcriptional activator protein PfeR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q48GG6 4.47e-06 50 28 2 107 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q39QJ2 5.03e-06 50 22 2 135 3 cheB5 Protein-glutamate methylesterase/protein-glutamine glutaminase 5 Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
Q485K0 5.32e-06 50 25 1 107 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
P0DMK7 5.74e-06 49 28 3 128 3 irlR Transcriptional activator protein IrlR Burkholderia pseudomallei (strain K96243)
I1WSZ4 5.74e-06 49 28 3 128 3 irlR Transcriptional activator protein IrlR Burkholderia pseudomallei (strain 1026b)
Q4UU85 6.62e-06 50 30 3 126 1 rpfG Cyclic di-GMP phosphodiesterase response regulator RpfG Xanthomonas campestris pv. campestris (strain 8004)
Q9KS59 7.93e-06 49 32 3 105 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P0AEC5 8.12e-06 50 26 4 135 1 barA Signal transduction histidine-protein kinase BarA Escherichia coli (strain K12)
P0AEC6 8.12e-06 50 26 4 135 1 barA Signal transduction histidine-protein kinase BarA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AEC7 8.12e-06 50 26 4 135 3 barA Signal transduction histidine-protein kinase BarA Escherichia coli O157:H7
Q7A0U4 8.34e-06 48 31 4 129 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain MW2)
Q9L524 8.34e-06 48 31 4 129 2 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus
Q6G972 8.34e-06 48 31 4 129 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain MSSA476)
Q6GGK6 8.34e-06 48 31 4 129 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain MRSA252)
Q7A5H6 8.34e-06 48 31 4 129 1 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain N315)
Q7A2R6 8.34e-06 48 31 4 129 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HFT0 8.34e-06 48 31 4 129 2 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain COL)
Q2FY79 8.34e-06 48 31 4 129 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain NCTC 8325 / PS 47)
P52939 9.18e-06 49 27 3 116 3 spo0A Stage 0 sporulation protein A homolog Clostridium innocuum
P07330 1.07e-05 49 28 2 106 1 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Escherichia coli (strain K12)
Q1CZL0 1.07e-05 49 25 1 106 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Myxococcus xanthus (strain DK1622)
Q87MK5 1.07e-05 49 27 2 107 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q322K2 1.09e-05 48 28 2 106 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Shigella boydii serotype 4 (strain Sb227)
Q83R52 1.11e-05 49 28 2 106 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Shigella flexneri
Q3Z2R1 1.12e-05 49 28 2 106 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Shigella sonnei (strain Ss046)
Q8FGP5 1.12e-05 49 28 2 106 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P23747 1.12e-05 49 32 3 111 1 algB Alginate biosynthesis transcriptional regulatory protein AlgB Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q8XCF9 1.13e-05 49 28 2 106 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Escherichia coli O157:H7
Q085K9 1.13e-05 49 25 4 152 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Shewanella frigidimarina (strain NCIMB 400)
P59342 1.15e-05 49 26 4 135 3 barA Signal transduction histidine-protein kinase BarA Shigella flexneri
Q00934 1.18e-05 49 35 4 108 1 pilR Response regulator protein PilR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q1RAQ1 1.18e-05 48 28 2 106 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Escherichia coli (strain UTI89 / UPEC)
Q0TGV0 1.18e-05 48 28 2 106 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
P0ACZ8 1.2e-05 48 31 4 121 1 cusR Transcriptional regulatory protein CusR Escherichia coli (strain K12)
P0ACZ9 1.2e-05 48 31 4 121 3 cusR Transcriptional regulatory protein CusR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AD00 1.2e-05 48 31 4 121 3 cusR Transcriptional regulatory protein CusR Escherichia coli O157:H7
P41789 1.21e-05 49 26 8 148 1 glnG DNA-binding transcriptional regulator NtrC Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q5H2V2 1.23e-05 48 28 0 80 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
P62635 1.27e-05 48 31 4 107 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)
Q2P5Q6 1.32e-05 48 28 0 80 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
P62646 1.33e-05 48 26 3 124 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
Q04942 1.44e-05 48 24 3 128 1 afsQ1 Transcriptional regulatory protein AfsQ1 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
P04042 1.49e-05 48 28 2 104 1 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q5PMY3 1.49e-05 48 28 2 104 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q2LSL3 1.55e-05 48 29 2 106 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Syntrophus aciditrophicus (strain SB)
Q1BRL2 1.6e-05 48 28 2 106 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Burkholderia orbicola (strain AU 1054)
Q57N81 1.62e-05 48 28 2 104 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Salmonella choleraesuis (strain SC-B67)
A8R3S7 1.64e-05 47 26 4 146 2 exaE Transcriptional activator protein ExaE Pseudomonas putida
Q8Z5V2 1.66e-05 48 28 2 104 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Salmonella typhi
P23620 1.74e-05 48 32 4 128 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q8P7A6 1.75e-05 48 28 0 81 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q4UWU6 1.75e-05 48 28 0 81 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Xanthomonas campestris pv. campestris (strain 8004)
Q9APD9 2.03e-05 48 30 4 116 3 zraR Transcriptional regulatory protein ZraR Klebsiella oxytoca
P28787 2.16e-05 48 27 3 105 3 ntrC DNA-binding transcriptional regulator NtrC Proteus hauseri
Q2SPQ1 2.21e-05 48 29 3 105 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Hahella chejuensis (strain KCTC 2396)
P32967 2.29e-05 47 29 2 103 1 gacA Response regulator GacA Pseudomonas protegens (strain DSM 19095 / LMG 27888 / CFBP 6595 / CHA0)
P0AFB8 2.36e-05 48 26 8 148 1 glnG DNA-binding transcriptional regulator NtrC Escherichia coli (strain K12)
P0AFB9 2.36e-05 48 26 8 148 3 glnG DNA-binding transcriptional regulator NtrC Escherichia coli O157:H7
Q21G20 2.4e-05 48 26 2 119 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
P25852 2.41e-05 48 30 4 118 1 zraR Transcriptional regulatory protein ZraR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8Z333 2.43e-05 48 30 4 118 3 zraR Transcriptional regulatory protein ZraR Salmonella typhi
Q9FAD8 2.61e-05 48 27 2 106 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Enterobacter cloacae
Q7NZB3 2.76e-05 48 23 1 107 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q7WJE7 2.86e-05 47 28 3 106 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q7VZ94 3e-05 47 28 2 106 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7WAA4 3.03e-05 47 28 3 106 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q1RJS1 3.43e-05 47 22 8 234 3 RBE_0312 Putative response regulator NtrX-like Rickettsia bellii (strain RML369-C)
Q1D225 3.49e-05 47 27 1 106 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Myxococcus xanthus (strain DK1622)
Q13SY2 3.55e-05 47 28 2 106 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Paraburkholderia xenovorans (strain LB400)
Q47744 4.31e-05 46 27 2 116 3 vanRB Regulatory protein VanRB Enterococcus faecalis (strain ATCC 700802 / V583)
Q63PS2 4.33e-05 47 28 2 106 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Burkholderia pseudomallei (strain K96243)
P21866 4.5e-05 46 33 3 118 1 kdpE KDP operon transcriptional regulatory protein KdpE Escherichia coli (strain K12)
Q3JY65 4.6e-05 47 28 2 106 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Burkholderia pseudomallei (strain 1710b)
Q62G12 4.6e-05 47 28 2 106 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Burkholderia mallei (strain ATCC 23344)
Q9RC52 4.7e-05 46 22 6 227 3 citT Transcriptional regulatory protein CitT Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q3IRR4 4.75e-05 47 26 2 102 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Natronomonas pharaonis (strain ATCC 35678 / DSM 2160 / CIP 103997 / JCM 8858 / NBRC 14720 / NCIMB 2260 / Gabara)
Q0ARY3 4.84e-05 47 30 4 113 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Maricaulis maris (strain MCS10)
Q2STS8 5.14e-05 47 28 2 106 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
A2XE31 5.18e-05 47 28 3 110 3 RR21 Two-component response regulator ORR21 Oryza sativa subsp. indica
Q44929 5.23e-05 46 28 4 148 3 gtcR Response regulator GtcR Aneurinibacillus migulanus
Q2KV65 5.28e-05 47 26 1 106 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Bordetella avium (strain 197N)
Q8H7S7 5.33e-05 47 28 3 110 2 RR21 Two-component response regulator ORR21 Oryza sativa subsp. japonica
Q39T95 5.39e-05 47 24 1 103 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
P13632 5.49e-05 47 23 3 146 1 dctD C4-dicarboxylate transport transcriptional regulatory protein DctD Rhizobium meliloti (strain 1021)
Q5V0B3 5.78e-05 47 23 3 116 1 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809)
Q5E3S1 6.46e-05 47 26 2 107 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q39KQ1 6.63e-05 47 28 2 106 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q6D6I7 6.8e-05 46 27 2 106 1 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
P27667 6.94e-05 45 27 3 120 3 uhpA Transcriptional regulatory protein UhpA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q669T5 8.93e-05 46 27 2 104 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Yersinia pseudotuberculosis serotype I (strain IP32953)
Q2L1D1 9.05e-05 46 27 3 106 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Bordetella avium (strain 197N)
Q3KHF6 9.14e-05 46 35 0 80 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Pseudomonas fluorescens (strain Pf0-1)
Q1CI99 9.18e-05 46 27 2 106 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Yersinia pestis bv. Antiqua (strain Nepal516)
Q8ZFM0 9.18e-05 46 27 2 106 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Yersinia pestis
Q1C6W3 9.18e-05 46 27 2 106 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Yersinia pestis bv. Antiqua (strain Antiqua)
O87940 0.000101 45 29 9 148 1 tdiR Transcriptional regulatory protein TdiR Thauera aromatica
Q8F6P9 0.000102 46 25 1 103 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
P62641 0.000102 46 25 1 103 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
Q9HUI2 0.000104 45 33 5 119 3 aruR Transcriptional regulatory protein AruR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q12PJ3 0.000108 46 26 2 107 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
P48259 0.000112 45 30 4 139 3 ycf27 Probable transcriptional regulator ycf27 Cyanophora paradoxa
Q0HWY6 0.000114 46 25 2 107 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Shewanella sp. (strain MR-7)
Q8PIM5 0.000114 46 27 0 81 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Xanthomonas axonopodis pv. citri (strain 306)
Q3BR57 0.000117 46 27 0 81 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q48F23 0.000119 45 31 1 105 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
P03029 0.000122 46 32 4 103 1 ntrC DNA-binding transcriptional regulator NtrC Klebsiella pneumoniae
Q0HKN5 0.000125 45 25 2 107 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Shewanella sp. (strain MR-4)
Q4ZWW3 0.000127 45 31 1 105 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Pseudomonas syringae pv. syringae (strain B728a)
Q88MS5 0.000127 45 33 0 80 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase of group 3 operon Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q8ECD7 0.000129 45 25 2 107 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
O49397 0.000132 46 28 3 110 1 ARR10 Two-component response regulator ARR10 Arabidopsis thaliana
O25408 0.000143 45 26 2 116 1 flgR Transcriptional regulatory protein FlgR Helicobacter pylori (strain ATCC 700392 / 26695)
P39928 0.000147 46 27 5 132 1 SLN1 Osmosensing histidine protein kinase SLN1 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P0AGA9 0.000186 44 26 3 120 3 uhpA Transcriptional regulatory protein UhpA Shigella flexneri
P0AGA6 0.000186 44 26 3 120 1 uhpA Transcriptional regulatory protein UhpA Escherichia coli (strain K12)
P0AGA7 0.000186 44 26 3 120 3 uhpA Transcriptional regulatory protein UhpA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AGA8 0.000186 44 26 3 120 3 uhpA Transcriptional regulatory protein UhpA Escherichia coli O157:H7
P37478 0.000205 45 31 4 119 1 walR Transcriptional regulatory protein WalR Bacillus subtilis (strain 168)
Q1BLQ3 0.000206 45 28 0 112 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Burkholderia orbicola (strain AU 1054)
P45605 0.000228 44 29 5 120 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Klebsiella pneumoniae
Q2INJ8 0.000228 45 30 3 109 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Anaeromyxobacter dehalogenans (strain 2CP-C)
Q394I6 0.000234 45 25 1 119 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
P13792 0.000251 44 31 4 106 1 phoP Alkaline phosphatase synthesis transcriptional regulatory protein PhoP Bacillus subtilis (strain 168)
A6X580 0.000297 42 26 2 115 3 divK Polar-differentiation response regulator DivK Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
Q63J47 0.000327 44 30 2 109 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Burkholderia pseudomallei (strain K96243)
Q3JJY2 0.000327 44 30 2 109 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Burkholderia pseudomallei (strain 1710b)
Q4V2X4 0.000327 44 30 2 109 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Burkholderia mallei (strain ATCC 23344)
P28257 0.000336 44 31 4 124 3 ycf27 Probable transcriptional regulator ycf27 Galdieria sulphuraria
P62598 0.000357 45 28 3 110 2 ARR12 Two-component response regulator ARR12 Arabidopsis thaliana
Q2T8Y6 0.000369 44 30 2 106 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q9TLQ4 0.000373 44 28 4 128 3 ycf27 Probable transcriptional regulator ycf27 Cyanidium caldarium
Q8VL08 0.000373 44 23 2 113 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Azospirillum brasilense
Q2T7Z3 0.00039 44 28 1 105 3 cheB4 Protein-glutamate methylesterase/protein-glutamine glutaminase 4 Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q2FWH6 0.000411 43 30 2 107 1 kdpE Transcriptional regulatory protein KdpE Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q23917 0.000422 44 30 5 122 1 regA 3',5'-cyclic-nucleotide phosphodiesterase regA Dictyostelium discoideum
Q393F2 0.000425 44 28 0 112 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q886S8 0.000434 44 29 1 105 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q20XK3 0.000456 44 31 4 116 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Rhodopseudomonas palustris (strain BisB18)
P23221 0.00046 43 24 5 121 3 fixJ Transcriptional regulatory protein FixJ Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q5HEP0 0.000483 43 25 2 120 3 vraR Response regulator protein VraR Staphylococcus aureus (strain COL)
Q2FX09 0.000483 43 25 2 120 1 vraR Response regulator protein VraR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q8DPL7 0.000507 43 28 3 125 1 walR Transcriptional regulatory protein WalR Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
A0A0H2UQ68 0.000507 43 28 3 125 1 walR Transcriptional regulatory protein WalR Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
A0A0H2ZN37 0.000507 43 28 3 125 1 walR Transcriptional regulatory protein WalR Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
P42012 0.000555 43 26 2 116 3 spo0A Stage 0 sporulation protein A Lysinibacillus sphaericus
P9WGL9 0.000594 43 26 3 123 1 regX3 Sensory transduction protein RegX3 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGL8 0.000594 43 26 3 123 2 regX3 Sensory transduction protein RegX3 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
O07130 0.000594 43 26 3 123 1 regX3 Sensory transduction protein RegX3 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
G7WMP8 0.000635 42 29 2 78 1 filR2 Probable methanogenesis regulatory protein FilR2 Methanothrix harundinacea (strain 6Ac)
Q1BMF9 0.000799 43 24 2 139 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Burkholderia orbicola (strain AU 1054)
P45607 0.000848 43 28 5 120 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Shigella flexneri
Q7A216 0.000882 43 29 4 123 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain MW2)
Q9RDT5 0.000882 43 29 4 123 1 walR Transcriptional regulatory protein WalR Staphylococcus aureus
A8YYU1 0.000882 43 29 4 123 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain USA300 / TCH1516)
Q6GD72 0.000882 43 29 4 123 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain MSSA476)
Q6GKS7 0.000882 43 29 4 123 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain MRSA252)
Q7A8E1 0.000882 43 29 4 123 1 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain N315)
Q99XF3 0.000882 43 29 4 123 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QD57 0.000882 43 29 4 123 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain Newman)
Q5HJX7 0.000882 43 29 4 123 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain COL)
Q2YUQ3 0.000882 43 29 4 123 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain bovine RF122 / ET3-1)
A5INQ9 0.000882 43 29 4 123 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain JH9)
Q2G2U6 0.000882 43 29 4 123 1 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FKN8 0.000882 43 29 4 123 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain USA300)
A6TXG8 0.000882 43 29 4 123 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain JH1)
A7WWQ5 0.000882 43 29 4 123 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q8CQK0 0.001 42 29 4 123 3 walR Transcriptional regulatory protein WalR Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HK18 0.001 42 29 4 123 3 walR Transcriptional regulatory protein WalR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q4KHL8 0.001 43 31 0 80 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
P45606 0.001 42 28 5 120 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Shigella dysenteriae

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS17095
Feature type CDS
Gene btsR
Product two-component system response regulator BtsR
Location 3759862 - 3760578 (strand: -1)
Length 717 (nucleotides) / 238 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_307
Orthogroup size 8
N. genomes 7

Actions

Genomic region

Domains

PF00072 Response regulator receiver domain
PF04397 LytTr DNA-binding domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3279 Transcription (K)
Signal transduction mechanisms (T)
KT DNA-binding response regulator, LytR/AlgR family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02477 two-component system, LytTR family, response regulator - -

Protein Sequence

MNILIVDDEPLARENLRCLLEEEKDIHIIGECSNAIEAIGEIHRKKPDVVFLDIQMPRITGLEMVSMLDPEHRPYIVFLTAFEEYAIQAFEEHAFDYLLKPLEQERLAKTLSRLRQGNKQNIDLLSPPEERLKCIPCTGHSRIWLMPIDEAVFATSRLSGVYVTNNQGQEGFTELTLRTLETRTPLVRCHRQYLVNMDYVNEIVFGDNGQAELILHNNKQIPVSRRYLKPLKEAIGLI

Flanking regions ( +/- flanking 50bp)

ATAAAAATCTGTTTACCCTTAGAAAAAAATATGGATAACGCAGCATAACAATGAATATATTAATCGTTGATGATGAGCCGCTTGCTCGTGAAAATTTACGTTGTTTACTCGAAGAAGAAAAAGATATTCATATTATTGGTGAATGCAGTAATGCTATTGAGGCGATAGGGGAAATACATCGTAAAAAACCTGATGTGGTTTTTCTTGATATTCAAATGCCACGTATTACTGGCTTAGAAATGGTCTCAATGCTTGATCCTGAACATCGCCCTTATATTGTCTTTTTAACGGCATTTGAAGAATATGCTATTCAAGCATTCGAAGAGCACGCTTTTGATTATTTGCTCAAACCATTAGAGCAAGAGCGTTTAGCCAAAACATTAAGTCGTTTACGCCAAGGCAATAAACAAAATATTGATTTATTATCACCACCAGAAGAACGCTTAAAGTGCATTCCTTGTACTGGGCATAGCCGTATTTGGCTAATGCCAATCGATGAAGCCGTGTTTGCTACATCACGATTAAGCGGTGTCTATGTCACCAATAATCAAGGGCAAGAAGGTTTTACTGAGCTTACATTACGTACTTTAGAAACACGCACTCCGCTGGTACGTTGCCATCGTCAATATTTAGTGAATATGGATTATGTCAATGAAATTGTTTTTGGTGATAATGGACAAGCAGAACTTATTTTACATAATAATAAACAAATTCCGGTCAGTCGACGTTACCTTAAACCCTTAAAAGAAGCGATTGGCTTAATTTAATCAGTAAAAAGGAATAAGCTTGATGGAACCCATTTATATTAAAGTTTATA