Homologs in group_307

Help

7 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_08715 FBDBKF_08715 100.0 Morganella morganii S1 btsR two-component system response regulator BtsR
EHELCC_12810 EHELCC_12810 100.0 Morganella morganii S2 btsR two-component system response regulator BtsR
LHKJJB_13405 LHKJJB_13405 100.0 Morganella morganii S3 btsR two-component system response regulator BtsR
HKOGLL_11625 HKOGLL_11625 100.0 Morganella morganii S5 btsR two-component system response regulator BtsR
F4V73_RS09935 F4V73_RS09935 95.8 Morganella psychrotolerans btsR two-component system response regulator BtsR
PMI_RS17080 PMI_RS17080 51.6 Proteus mirabilis HI4320 - hypothetical protein
PMI_RS17095 PMI_RS17095 75.4 Proteus mirabilis HI4320 btsR two-component system response regulator BtsR

Distribution of the homologs in the orthogroup group_307

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_307

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q8ZNN2 1.94e-119 342 67 1 238 3 btsR Transcriptional regulatory protein BtsR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8Z5C1 8.7e-119 341 67 1 238 3 btsR Transcriptional regulatory protein BtsR Salmonella typhi
P0AFT5 9.89e-118 338 67 1 238 1 btsR Transcriptional regulatory protein BtsR Escherichia coli (strain K12)
P0AFT6 9.89e-118 338 67 1 238 3 btsR Transcriptional regulatory protein BtsR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0DUE6 9.89e-118 338 67 1 238 3 btsR Transcriptional regulatory protein BtsR Escherichia coli O157:H7
P0DUE7 9.89e-118 338 67 1 238 4 btsR Transcriptional regulatory protein-like BtsR Enterobacteria phage VT1-Sakai
P59640 1.1e-117 338 67 1 238 3 btsR Transcriptional regulatory protein BtsR Shigella flexneri
Q8ZBV2 6.3e-86 258 55 2 237 3 YPO3287 Uncharacterized response regulatory protein YPO3287/y0902/YP_0397 Yersinia pestis
Q9KU36 1.64e-81 246 51 1 236 3 VC_0693 Uncharacterized response regulatory protein VC_0693 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q8DET1 1.55e-80 244 52 2 240 3 VV1_0503 Uncharacterized response regulatory protein VV1_0503 Vibrio vulnificus (strain CMCP6)
Q87S86 6.54e-80 243 52 3 243 3 VP0538 Uncharacterized response regulatory protein VP0538 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q8EDD7 5.05e-70 217 46 2 236 3 SO_2823 Uncharacterized response regulatory protein SO_2823 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q82Z76 1.3e-45 155 35 6 245 4 lytT Sensory transduction protein LytT Enterococcus faecalis (strain ATCC 700802 / V583)
Q81JL3 1.59e-40 142 35 4 244 3 lytT Sensory transduction protein LytT Bacillus anthracis
Q814J1 2.52e-40 141 35 4 244 4 lytT Sensory transduction protein LytT Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q8D4U6 2.15e-35 129 31 5 244 3 VV2_1193 Uncharacterized response regulatory protein VV2_1193 Vibrio vulnificus (strain CMCP6)
P94514 1.04e-34 127 33 4 241 3 lytT Sensory transduction protein LytT Bacillus subtilis (strain 168)
Q8FFE0 1.94e-31 118 30 7 247 3 ypdB Transcriptional regulatory protein YpdB Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AE41 3.12e-31 118 30 7 246 3 ypdB Transcriptional regulatory protein YpdB Shigella flexneri
P0AE39 3.12e-31 118 30 7 246 1 ypdB Transcriptional regulatory protein YpdB Escherichia coli (strain K12)
P0AE40 3.12e-31 118 30 7 246 3 ypdB Transcriptional regulatory protein YpdB Escherichia coli O157:H7
Q8DVB7 1.47e-28 111 32 7 250 3 lytR Sensory transduction protein LytR Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q4A010 4.7e-28 110 28 6 263 3 lytR Sensory transduction protein LytR Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q5HLG2 7.63e-28 109 30 5 252 3 lytR Sensory transduction protein LytR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q2YV67 2.18e-27 108 26 4 247 3 lytR Transcriptional regulatory protein LytR Staphylococcus aureus (strain bovine RF122 / ET3-1)
P60610 2.32e-27 108 26 5 247 3 lytR Transcriptional regulatory protein LytR Staphylococcus aureus (strain N315)
P60609 2.32e-27 108 26 5 247 1 lytR Transcriptional regulatory protein LytR Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HJB5 2.32e-27 108 26 5 247 3 lytR Transcriptional regulatory protein LytR Staphylococcus aureus (strain COL)
P60611 2.32e-27 108 26 5 247 1 lytR Transcriptional regulatory protein LytR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FK09 2.32e-27 108 26 5 247 3 lytR Transcriptional regulatory protein LytR Staphylococcus aureus (strain USA300)
Q8E217 4.66e-27 107 29 6 247 3 lytR Sensory transduction protein LytR Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8E7H3 4.66e-27 107 29 6 247 3 lytR Sensory transduction protein LytR Streptococcus agalactiae serotype III (strain NEM316)
Q87K77 5.79e-27 107 27 6 251 3 VPA0021 Uncharacterized response regulatory protein VPA0021 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q8CN55 8.27e-27 106 30 5 252 3 lytR Sensory transduction protein LytR Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q8NYH3 9.26e-27 106 25 4 247 3 lytR Transcriptional regulatory protein LytR Staphylococcus aureus (strain MW2)
Q6GCL1 9.26e-27 106 25 4 247 3 lytR Transcriptional regulatory protein LytR Staphylococcus aureus (strain MSSA476)
Q6GK51 1.01e-26 106 25 4 247 3 lytR Transcriptional regulatory protein LytR Staphylococcus aureus (strain MRSA252)
Q4L8V4 5.73e-26 104 26 5 267 3 lytR Sensory transduction protein LytR Staphylococcus haemolyticus (strain JCSC1435)
Q9KL96 5.97e-26 104 31 8 248 3 VC_A0850 Uncharacterized response regulatory protein VC_A0850 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q8EQQ3 2e-25 103 30 5 243 3 lytT Sensory transduction protein LytT Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
P26275 3.72e-25 102 33 6 239 3 algR Positive alginate biosynthesis regulatory protein Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P21649 8.28e-21 91 29 3 173 1 mrkE Protein MrkE Klebsiella pneumoniae
P55184 2.64e-14 72 33 2 121 3 yxjL Uncharacterized transcriptional regulatory protein YxjL Bacillus subtilis (strain 168)
P96686 1.61e-13 70 34 2 122 3 ydfI Transcriptional regulatory protein YdfI Bacillus subtilis (strain 168)
Q5JF95 1.74e-12 69 34 1 105 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
A1SMR4 2.01e-12 68 34 3 124 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Nocardioides sp. (strain ATCC BAA-499 / JS614)
Q8TLG9 9.25e-12 67 36 3 124 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q9UYF3 9.38e-12 67 30 1 105 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Pyrococcus abyssi (strain GE5 / Orsay)
Q24T61 1.2e-11 67 34 1 105 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Desulfitobacterium hafniense (strain Y51)
Q2IQS6 1.58e-11 66 30 5 189 3 cheB5 Protein-glutamate methylesterase/protein-glutamine glutaminase 5 Anaeromyxobacter dehalogenans (strain 2CP-C)
O58192 2.29e-11 65 26 2 131 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
P13800 3.3e-11 64 28 2 143 1 degU Transcriptional regulatory protein DegU Bacillus subtilis (strain 168)
Q48ND9 3.4e-11 65 33 2 106 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q56312 3.81e-11 62 29 2 117 1 cheY Chemotaxis protein CheY Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
O87717 3.86e-11 65 31 5 167 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q1IQS9 6.84e-11 64 34 2 111 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Koribacter versatilis (strain Ellin345)
Q12YX1 7.36e-11 64 29 2 118 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M)
O85128 7.87e-11 64 37 2 105 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Agrobacterium fabrum (strain C58 / ATCC 33970)
Q888V8 9.11e-11 64 33 2 106 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q4ZYD3 9.2e-11 64 33 2 106 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Pseudomonas syringae pv. syringae (strain B728a)
Q46DT6 9.64e-11 64 37 1 105 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Methanosarcina barkeri (strain Fusaro / DSM 804)
Q6AJV3 1.05e-10 63 37 2 109 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Desulfotalea psychrophila (strain LSv54 / DSM 12343)
Q2RKH8 1.11e-10 64 33 1 112 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
Q8Q009 1.21e-10 63 35 4 123 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
P94439 1.32e-10 62 30 5 136 1 lnrK Transcriptional regulatory protein LnrK Bacillus subtilis (strain 168)
Q0AXB7 1.49e-10 63 34 0 101 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
Q2KCH8 1.58e-10 63 38 3 109 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q31HL9 1.95e-10 63 33 1 105 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q8TUQ0 2.27e-10 63 35 1 105 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
O07528 3.09e-10 61 30 2 113 3 yhcZ Uncharacterized transcriptional regulatory protein YhcZ Bacillus subtilis (strain 168)
Q3ADA6 3.11e-10 62 38 4 108 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
Q7NV40 3.6e-10 62 35 2 110 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q9WYN9 3.85e-10 62 28 1 105 1 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q8EQW0 4.26e-10 62 30 1 109 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q3ADG9 4.37e-10 62 33 1 103 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
Q52883 7.65e-10 61 39 3 106 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase of group 1 operon Rhizobium meliloti (strain 1021)
Q0AYL3 8.17e-10 61 31 2 111 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
P62640 8.28e-10 61 28 1 105 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Q2FMT2 1.05e-09 61 35 2 104 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1)
P70955 1.55e-09 59 21 5 206 1 natR Transcriptional regulatory protein NatR Bacillus subtilis (strain 168)
Q8PX96 1.84e-09 60 36 1 105 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q5L0L0 2e-09 60 31 1 112 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Geobacillus kaustophilus (strain HTA426)
Q1MLG8 2.16e-09 60 36 3 109 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q7MBQ5 2.28e-09 60 33 1 105 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Vibrio vulnificus (strain YJ016)
Q47I43 3.01e-09 59 35 1 103 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Dechloromonas aromatica (strain RCB)
P0A4H5 3.49e-09 56 27 2 116 3 cheY Chemotaxis protein CheY Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
P0A4H6 3.49e-09 56 27 2 116 3 cheY Chemotaxis protein CheY Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
P39486 5.03e-09 58 23 2 130 3 dctR Probable C4-dicarboxylate response regulator DctR Priestia megaterium
Q4UU97 5.19e-09 58 35 1 105 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Xanthomonas campestris pv. campestris (strain 8004)
Q8P9J7 5.19e-09 58 35 1 105 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q1D359 5.36e-09 58 28 1 103 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Myxococcus xanthus (strain DK1622)
Q30ZJ5 5.62e-09 58 30 1 105 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
Q9KA55 6.02e-09 58 32 1 112 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q167K9 6.33e-09 58 34 1 111 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
P52934 6.71e-09 58 33 4 114 1 spo0A Stage 0 sporulation protein A Geobacillus stearothermophilus
Q1IRH0 7.02e-09 58 40 2 104 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Koribacter versatilis (strain Ellin345)
P62636 7.54e-09 58 33 1 103 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
Q8D4X6 8.23e-09 58 32 1 105 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Vibrio vulnificus (strain CMCP6)
Q132U2 9.03e-09 58 30 1 106 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Rhodopseudomonas palustris (strain BisB5)
Q20YL8 9.18e-09 58 29 1 106 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Rhodopseudomonas palustris (strain BisB18)
Q88EW5 9.36e-09 58 31 3 120 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase of group 1 operon Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q8NYJ9 9.52e-09 57 30 5 119 3 hptR Transcriptional regulatory protein HptR Staphylococcus aureus (strain MW2)
Q6GCQ3 9.52e-09 57 30 5 119 3 hptR Transcriptional regulatory protein HptR Staphylococcus aureus (strain MSSA476)
Q5HJF7 9.52e-09 57 30 5 119 2 hptR Transcriptional regulatory protein HptR Staphylococcus aureus (strain COL)
Q2G1E1 9.52e-09 57 30 5 119 1 hptR Transcriptional regulatory protein HptR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FK47 9.52e-09 57 30 5 119 3 hptR Transcriptional regulatory protein HptR Staphylococcus aureus (strain USA300)
Q2SFK0 1.02e-08 58 34 2 106 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Hahella chejuensis (strain KCTC 2396)
Q8EF61 1.13e-08 58 31 1 105 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q6GK93 1.15e-08 57 30 5 119 3 hptR Transcriptional regulatory protein HptR Staphylococcus aureus (strain MRSA252)
Q7A7X9 1.17e-08 57 29 5 121 1 hptR Transcriptional regulatory protein HptR Staphylococcus aureus (strain N315)
Q99X00 1.17e-08 57 29 5 121 3 hptR Transcriptional regulatory protein HptR Staphylococcus aureus (strain Mu50 / ATCC 700699)
P43501 1.21e-08 55 32 3 120 3 pilH Protein PilH Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q7NSI8 1.23e-08 58 35 2 108 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q2YV56 1.27e-08 57 30 5 119 3 hptR Transcriptional regulatory protein HptR Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q2IT50 1.29e-08 58 29 1 106 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Rhodopseudomonas palustris (strain HaA2)
Q2LSL3 1.35e-08 57 36 2 105 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Syntrophus aciditrophicus (strain SB)
O52262 1.4e-08 57 31 3 120 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Pseudomonas putida
P0AEF7 1.6e-08 56 35 5 122 3 dpiA Transcriptional regulatory protein DpiA Shigella flexneri
P0AEF4 1.6e-08 56 35 5 122 1 dpiA Transcriptional regulatory protein DpiA Escherichia coli (strain K12)
P0AEF5 1.6e-08 56 35 5 122 3 dpiA Transcriptional regulatory protein DpiA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AEF6 1.6e-08 56 35 5 122 3 dpiA Transcriptional regulatory protein DpiA Escherichia coli O157:H7
Q5QZQ3 1.64e-08 57 31 2 107 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q820K0 1.67e-08 57 31 3 130 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
P62637 1.79e-08 57 28 8 195 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
O32197 1.97e-08 56 27 2 121 2 liaR Transcriptional regulatory protein LiaR Bacillus subtilis (strain 168)
Q0AWZ8 1.98e-08 57 30 2 105 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
Q2YC79 2.16e-08 57 31 0 96 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
O83639 2.3e-08 57 31 3 113 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Treponema pallidum (strain Nichols)
Q3SIG0 2.51e-08 57 32 1 105 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Thiobacillus denitrificans (strain ATCC 25259)
P62644 2.59e-08 57 30 1 106 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase of group 2 operon Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q30RX5 2.79e-08 57 32 1 105 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251)
Q97GZ3 2.79e-08 57 30 2 119 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
P0ACZ7 3.05e-08 55 35 1 81 1 evgA DNA-binding transcriptional activator EvgA Shigella flexneri
P0ACZ4 3.05e-08 55 35 1 81 1 evgA DNA-binding transcriptional activator EvgA Escherichia coli (strain K12)
P0ACZ5 3.05e-08 55 35 1 81 3 evgA DNA-binding transcriptional activator EvgA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0ACZ6 3.05e-08 55 35 1 81 3 evgA DNA-binding transcriptional activator EvgA Escherichia coli O157:H7
P54662 3.06e-08 56 25 1 120 3 degU Transcriptional regulatory protein DegU Brevibacillus brevis
P62646 3.19e-08 56 31 2 113 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
Q9I6V9 3.43e-08 56 31 1 105 1 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q1QI44 3.84e-08 56 30 1 106 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
Q05522 4.02e-08 56 31 2 112 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Bacillus subtilis (strain 168)
Q89SQ1 4.43e-08 56 31 3 123 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase of group 3 operon Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
P52931 5.02e-08 55 30 5 140 3 spo0A Stage 0 sporulation protein A (Fragment) Niallia circulans
Q3KFZ6 5.19e-08 56 33 2 107 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Pseudomonas fluorescens (strain Pf0-1)
Q3A5A8 5.95e-08 55 29 1 107 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
Q1MP86 6.23e-08 55 32 2 102 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Lawsonia intracellularis (strain PHE/MN1-00)
O34723 6.28e-08 54 30 3 121 1 desR Transcriptional regulatory protein DesR Bacillus subtilis (strain 168)
Q5GYV8 7.39e-08 55 34 1 105 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
Q2P1V8 7.39e-08 55 34 1 105 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q3BUA2 7.74e-08 55 34 1 105 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q8PLB4 7.74e-08 55 34 1 105 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Xanthomonas axonopodis pv. citri (strain 306)
Q0A9Z5 8.43e-08 55 33 0 65 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q2RUI8 8.74e-08 55 32 2 106 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q2RZD2 8.96e-08 55 28 3 125 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Salinibacter ruber (strain DSM 13855 / M31)
Q9KT84 9.41e-08 55 36 3 91 1 luxO Regulatory protein LuxO Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q7MM78 1e-07 55 35 4 91 3 luxO Regulatory protein LuxO Vibrio vulnificus (strain YJ016)
Q8CWJ5 1e-07 55 35 4 91 3 luxO Regulatory protein LuxO Vibrio vulnificus (strain CMCP6)
Q1MC14 1.08e-07 55 35 2 105 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q20XE6 1.11e-07 55 35 3 114 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Rhodopseudomonas palustris (strain BisB18)
Q39S45 1.13e-07 55 36 2 106 3 cheB4 Protein-glutamate methylesterase/protein-glutamine glutaminase 4 Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
Q67P67 1.16e-07 55 31 2 118 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
Q6LTM2 1.2e-07 55 29 2 107 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Photobacterium profundum (strain SS9)
Q3SVA1 1.2e-07 55 30 1 106 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
Q3J1W3 1.29e-07 55 34 2 103 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
Q8KLS5 1.44e-07 54 34 2 103 1 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase of group 2 operon Cereibacter sphaeroides
Q7A0I0 1.5e-07 53 25 2 121 3 vraR Response regulator protein VraR Staphylococcus aureus (strain MW2)
Q6G850 1.5e-07 53 25 2 121 3 vraR Response regulator protein VraR Staphylococcus aureus (strain MSSA476)
Q6GFH3 1.5e-07 53 25 2 121 3 vraR Response regulator protein VraR Staphylococcus aureus (strain MRSA252)
Q7A4R9 1.5e-07 53 25 2 121 1 vraR Response regulator protein VraR Staphylococcus aureus (strain N315)
Q7A2Q1 1.5e-07 53 25 2 121 1 vraR Response regulator protein VraR Staphylococcus aureus (strain Mu50 / ATCC 700699)
P0C0Z1 1.5e-07 53 25 2 121 3 vraR Response regulator protein VraR Staphylococcus aureus (strain Mu3 / ATCC 700698)
O07019 1.6e-07 53 28 2 121 3 yvfU Uncharacterized transcriptional regulatory protein YvfU Bacillus subtilis (strain 168)
P52929 1.78e-07 53 32 7 147 3 spo0A Stage 0 sporulation protein A (Fragment) Brevibacillus parabrevis
Q2LR65 1.79e-07 54 31 2 106 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Syntrophus aciditrophicus (strain SB)
Q2W2W9 1.79e-07 54 32 1 103 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
Q1QVY7 1.81e-07 54 33 2 106 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q8XQ83 1.81e-07 54 31 1 105 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q485K0 1.82e-07 54 27 2 135 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q06065 2.22e-07 54 30 5 144 1 atoC Regulatory protein AtoC Escherichia coli (strain K12)
Q10WZ6 2.33e-07 54 28 2 119 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Trichodesmium erythraeum (strain IMS101)
Q2ILG8 2.53e-07 53 31 3 126 3 cheB6 Protein-glutamate methylesterase/protein-glutamine glutaminase 6 Anaeromyxobacter dehalogenans (strain 2CP-C)
P62645 2.8e-07 53 28 2 123 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase of group 3 operon Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q0HVI0 2.81e-07 53 30 1 105 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Shewanella sp. (strain MR-7)
Q87MX7 2.83e-07 53 34 4 91 3 luxO Regulatory protein LuxO Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q0HIF6 2.86e-07 53 30 1 105 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Shewanella sp. (strain MR-4)
P0C5S5 2.91e-07 53 34 4 91 3 luxO Luminescence regulatory protein LuxO Vibrio harveyi
A7MVC2 2.91e-07 53 34 4 91 1 luxO Luminescence regulatory protein LuxO Vibrio campbellii (strain ATCC BAA-1116)
Q1CX06 3.27e-07 53 38 0 63 3 cheB4 Protein-glutamate methylesterase/protein-glutamine glutaminase 4 Myxococcus xanthus (strain DK1622)
Q4KG36 3.27e-07 53 32 2 107 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q1LH11 3.3e-07 53 32 2 106 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
P52688 3.45e-07 53 28 3 132 1 citB Transcriptional regulatory protein CitB Klebsiella pneumoniae
Q39T95 3.47e-07 53 27 2 104 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
P35163 3.62e-07 53 30 3 133 1 resD Transcriptional regulatory protein ResD Bacillus subtilis (strain 168)
Q46PH7 3.78e-07 53 32 2 106 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q5HKE0 3.91e-07 53 30 5 132 3 SERP2406 Uncharacterized response regulatory protein SERP2406 Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q21G20 3.93e-07 53 30 2 124 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
P44845 4e-07 52 27 3 124 3 narP Nitrate/nitrite response regulator protein homolog Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q2RRX2 4.14e-07 53 29 3 122 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q8F3H4 4.15e-07 53 33 2 105 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
P62643 4.15e-07 53 33 2 105 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
O87125 4.2e-07 53 30 3 120 1 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P52941 4.57e-07 52 33 3 135 3 spo0A Stage 0 sporulation protein A homolog Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
P0AF31 5.3e-07 52 32 2 135 3 narL Nitrate/nitrite response regulator protein NarL Shigella flexneri
P0AF28 5.3e-07 52 32 2 135 1 narL Nitrate/nitrite response regulator protein NarL Escherichia coli (strain K12)
P0AF29 5.3e-07 52 32 2 135 3 narL Nitrate/nitrite response regulator protein NarL Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AF30 5.3e-07 52 32 2 135 3 narL Nitrate/nitrite response regulator protein NarL Escherichia coli O157:H7
P62639 5.72e-07 53 24 6 210 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Q15RF6 6.09e-07 53 28 4 138 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q65JK6 6.25e-07 52 27 1 112 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q4ZQV7 7.28e-07 52 30 3 120 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Pseudomonas syringae pv. syringae (strain B728a)
P9WGM3 7.62e-07 51 34 3 104 1 pdtaR Transcriptional regulatory protein PdtaR Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM2 7.62e-07 51 34 3 104 3 pdtaR Transcriptional regulatory protein PdtaR Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0AED6 7.93e-07 51 29 2 121 3 uvrY Response regulator UvrY Shigella flexneri
P0AED5 7.93e-07 51 29 2 121 1 uvrY Response regulator UvrY Escherichia coli (strain K12)
Q48GG6 7.99e-07 52 30 3 120 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q884V3 8.03e-07 52 30 3 120 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
P31802 8.57e-07 51 33 3 118 3 narP Nitrate/nitrite response regulator protein NarP Escherichia coli (strain K12)
P66797 8.64e-07 51 29 2 121 3 uvrY Response regulator UvrY Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P66798 8.64e-07 51 29 2 121 3 uvrY Response regulator UvrY Escherichia coli O157:H7
Q39WQ9 8.91e-07 52 35 2 105 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
Q8CQE3 9.18e-07 52 28 5 132 3 SE_0165 Uncharacterized response regulatory protein SE_0165 Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5E3S1 1.03e-06 52 28 2 107 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q311M8 1.09e-06 52 32 3 114 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
Q7A029 1.11e-06 51 27 3 122 3 nreC Oxygen regulatory protein NreC Staphylococcus aureus (strain MW2)
A8Z580 1.11e-06 51 27 3 122 3 nreC Oxygen regulatory protein NreC Staphylococcus aureus (strain USA300 / TCH1516)
Q6G6T0 1.11e-06 51 27 3 122 3 nreC Oxygen regulatory protein NreC Staphylococcus aureus (strain MSSA476)
Q7A3U5 1.11e-06 51 27 3 122 3 nreC Oxygen regulatory protein NreC Staphylococcus aureus (strain N315)
Q99RN8 1.11e-06 51 27 3 122 3 nreC Oxygen regulatory protein NreC Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QJN1 1.11e-06 51 27 3 122 3 nreC Oxygen regulatory protein NreC Staphylococcus aureus (strain Newman)
Q5HDG5 1.11e-06 51 27 3 122 3 nreC Oxygen regulatory protein NreC Staphylococcus aureus (strain COL)
A5IVH2 1.11e-06 51 27 3 122 3 nreC Oxygen regulatory protein NreC Staphylococcus aureus (strain JH9)
Q2FVM7 1.11e-06 51 27 3 122 3 nreC Oxygen regulatory protein NreC Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FEA6 1.11e-06 51 27 3 122 3 nreC Oxygen regulatory protein NreC Staphylococcus aureus (strain USA300)
A6U4C0 1.11e-06 51 27 3 122 3 nreC Oxygen regulatory protein NreC Staphylococcus aureus (strain JH1)
A7X623 1.11e-06 51 27 3 122 3 nreC Oxygen regulatory protein NreC Staphylococcus aureus (strain Mu3 / ATCC 700698)
O05251 1.12e-06 51 32 5 124 3 malR Transcriptional regulatory protein MalR Bacillus subtilis (strain 168)
Q221I1 1.13e-06 52 32 3 107 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Q6GE42 1.14e-06 51 27 3 122 3 nreC Oxygen regulatory protein NreC Staphylococcus aureus (strain MRSA252)
Q2YZ42 1.14e-06 51 27 3 122 3 nreC Oxygen regulatory protein NreC Staphylococcus aureus (strain bovine RF122 / ET3-1)
O29221 1.18e-06 52 31 2 105 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
Q8RAZ3 1.31e-06 52 31 3 107 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q3IDZ3 1.34e-06 52 28 2 107 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Pseudoalteromonas translucida (strain TAC 125)
Q6D6I7 1.49e-06 51 28 1 105 1 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q2SPQ1 1.49e-06 51 32 1 104 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Hahella chejuensis (strain KCTC 2396)
Q1CWZ9 1.5e-06 51 30 2 113 3 cheB5 Protein-glutamate methylesterase/protein-glutamine glutaminase 5 Myxococcus xanthus (strain DK1622)
Q8EEQ0 1.64e-06 51 31 2 105 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q2FQU2 1.65e-06 51 38 0 62 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1)
P51586 1.65e-06 49 33 3 108 3 None Uncharacterized 14.6 kDa protein in sodA1 3'region Leptolyngbya boryana
Q2T8Y5 1.83e-06 51 30 1 105 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q7MIQ5 1.84e-06 51 29 2 107 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Vibrio vulnificus (strain YJ016)
Q2SBX9 1.89e-06 51 26 4 154 3 cheB4 Protein-glutamate methylesterase/protein-glutamine glutaminase 4 Hahella chejuensis (strain KCTC 2396)
P9WMF9 2.01e-06 50 27 1 121 1 devR DNA-binding transcriptional activator DevR/DosR Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WMF8 2.01e-06 50 27 1 121 2 devR DNA-binding transcriptional activator DevR/DosR Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q8DB67 2.02e-06 51 29 2 107 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Vibrio vulnificus (strain CMCP6)
Q21IQ9 2.06e-06 51 29 2 103 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
P62635 2.21e-06 51 34 4 107 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)
Q51373 2.22e-06 50 25 1 121 3 gacA Response regulator GacA Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P95582 2.28e-06 50 30 2 103 3 gacA Response regulator GacA Pseudomonas viridiflava
Q52376 2.39e-06 50 30 2 103 3 gacA Response regulator GacA Pseudomonas syringae pv. syringae (strain B728a)
Q39SY1 2.45e-06 51 27 1 105 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
P52932 2.54e-06 50 32 5 124 3 spo0A Stage 0 sporulation protein A (Fragment) Priestia megaterium
Q8CN75 2.62e-06 50 27 3 122 3 nreC Oxygen regulatory protein NreC Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q1GZZ0 2.69e-06 50 29 1 105 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
P62647 2.9e-06 50 26 1 112 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Methanococcus maripaludis (strain DSM 14266 / JCM 13030 / NBRC 101832 / S2 / LL)
Q1CI99 3.06e-06 50 28 1 103 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Yersinia pestis bv. Antiqua (strain Nepal516)
Q8ZFM0 3.06e-06 50 28 1 103 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Yersinia pestis
Q1C6W3 3.06e-06 50 28 1 103 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Yersinia pestis bv. Antiqua (strain Antiqua)
Q669T5 3.11e-06 50 28 1 103 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Yersinia pseudotuberculosis serotype I (strain IP32953)
Q5HLK6 3.3e-06 50 27 3 122 3 nreC Oxygen regulatory protein NreC Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q085K9 3.59e-06 50 26 1 113 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Shewanella frigidimarina (strain NCIMB 400)
Q7N5T1 3.69e-06 50 25 9 249 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
P24072 3.8e-06 48 27 3 117 1 cheY Chemotaxis protein CheY Bacillus subtilis (strain 168)
Q44006 3.88e-06 49 29 4 135 2 czcR Transcriptional activator protein CzcR Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q7WAA4 3.97e-06 50 29 1 105 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WJE7 3.97e-06 50 29 1 105 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q7VZ94 4.16e-06 50 29 1 105 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7NZB3 4.61e-06 50 25 4 152 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q9KS59 4.76e-06 50 31 2 105 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P62638 5.25e-06 50 26 1 106 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Q322K2 5.62e-06 50 28 1 105 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Shigella boydii serotype 4 (strain Sb227)
Q9RC52 6e-06 49 27 4 142 3 citT Transcriptional regulatory protein CitT Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q9KQD8 6.47e-06 50 27 1 107 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P07330 7.29e-06 49 29 1 103 1 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Escherichia coli (strain K12)
Q8XCF9 7.49e-06 49 29 1 103 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Escherichia coli O157:H7
Q1RAQ1 7.56e-06 49 29 1 103 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Escherichia coli (strain UTI89 / UPEC)
Q0TGV0 7.56e-06 49 29 1 103 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q83R52 7.77e-06 49 29 1 103 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Shigella flexneri
Q3Z2R1 7.85e-06 49 29 1 103 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Shigella sonnei (strain Ss046)
Q8FGP5 7.85e-06 49 29 1 103 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q9K998 8.05e-06 48 26 2 116 3 dctR Probable C4-dicarboxylate response regulator DctR Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q89T55 8.77e-06 49 26 1 106 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase of group 2 operon Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
P04042 8.85e-06 49 29 1 103 1 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q5PMY3 8.85e-06 49 29 1 103 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q57N81 9.26e-06 49 29 1 103 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Salmonella choleraesuis (strain SC-B67)
Q8Z5V2 9.44e-06 49 29 1 103 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Salmonella typhi
P24908 1.05e-05 48 39 1 66 1 PA0034 Putative transcriptional regulator Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
A0R3I8 1.13e-05 48 34 6 120 1 mprA Response regulator MprA Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
P45709 1.15e-05 47 29 4 117 3 ccdB Protein CcdB Bacillus subtilis (strain 168)
Q9CD68 1.25e-05 48 33 4 112 3 mprA Response regulator MprA Mycobacterium leprae (strain TN)
A0QTK2 1.32e-05 48 32 4 125 1 mtrA DNA-binding response regulator MtrA Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q1B3X8 1.38e-05 48 32 7 134 3 mprA Response regulator MprA Mycobacterium sp. (strain MCS)
A1UL70 1.38e-05 48 32 7 134 3 mprA Response regulator MprA Mycobacterium sp. (strain KMS)
A3Q5L9 1.38e-05 48 32 7 134 3 mprA Response regulator MprA Mycobacterium sp. (strain JLS)
P9WGM5 1.39e-05 48 26 2 121 1 narL Probable transcriptional regulatory protein NarL Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM4 1.39e-05 48 26 2 121 3 narL Probable transcriptional regulatory protein NarL Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q742C1 1.5e-05 48 34 6 120 3 mprA Response regulator MprA Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
A0QBQ9 1.5e-05 48 34 6 120 3 mprA Response regulator MprA Mycobacterium avium (strain 104)
Q1M7A0 1.54e-05 48 23 1 120 3 mctR Transcriptional regulatory protein MctR Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q1BRL2 1.6e-05 48 29 1 105 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Burkholderia orbicola (strain AU 1054)
Q63PS2 1.6e-05 48 29 1 105 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Burkholderia pseudomallei (strain K96243)
Q3JY65 1.7e-05 48 29 1 105 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Burkholderia pseudomallei (strain 1710b)
Q62G12 1.7e-05 48 29 1 105 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Burkholderia mallei (strain ATCC 23344)
Q2STS8 1.78e-05 48 29 1 105 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
O31517 1.82e-05 48 26 6 149 3 yesN Uncharacterized transcriptional regulatory protein YesN Bacillus subtilis (strain 168)
Q2L1D1 1.98e-05 48 27 1 105 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Bordetella avium (strain 197N)
P52928 2.1e-05 48 29 2 112 3 spo0A Stage 0 sporulation protein A Bacillus anthracis
P0A4H2 2.16e-05 47 41 3 67 1 bvgA Virulence factors putative positive transcription regulator BvgA Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
P0A4H4 2.16e-05 47 41 3 67 3 bvgA Virulence factors putative positive transcription regulator BvgA Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
P0A4H3 2.16e-05 47 41 3 67 3 bvgA Virulence factors putative positive transcription regulator BvgA Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
P0AEC5 2.23e-05 48 25 8 221 1 barA Signal transduction histidine-protein kinase BarA Escherichia coli (strain K12)
P0AEC6 2.23e-05 48 25 8 221 1 barA Signal transduction histidine-protein kinase BarA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AEC7 2.23e-05 48 25 8 221 3 barA Signal transduction histidine-protein kinase BarA Escherichia coli O157:H7
Q87MK5 2.39e-05 48 28 2 107 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q13SY2 2.59e-05 48 29 1 105 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Paraburkholderia xenovorans (strain LB400)
Q39KQ1 2.64e-05 48 29 1 105 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q12PJ3 2.87e-05 48 27 2 125 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
A1TEL7 2.92e-05 47 34 6 120 3 mprA Response regulator MprA Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
P0A4I4 2.94e-05 47 29 2 112 3 spo0A Stage 0 sporulation protein A Bacillus thuringiensis
P0A4I3 2.94e-05 47 29 2 112 3 spo0A Stage 0 sporulation protein A Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q12IZ9 2.97e-05 47 28 2 103 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
P52938 3.15e-05 47 26 4 142 3 spo0A Stage 0 sporulation protein A homolog Clostridioides difficile
Q9FAD8 3.28e-05 47 27 1 105 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Enterobacter cloacae
Q2IQ87 3.45e-05 47 27 0 83 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Anaeromyxobacter dehalogenans (strain 2CP-C)
P0AEV3 3.54e-05 47 33 6 121 3 rssB Regulator of RpoS Shigella flexneri
P0AEV1 3.54e-05 47 33 6 121 1 rssB Regulator of RpoS Escherichia coli (strain K12)
P0AEV2 3.54e-05 47 33 6 121 3 rssB Regulator of RpoS Escherichia coli O157:H7
Q39QJ2 4.14e-05 47 28 2 106 3 cheB5 Protein-glutamate methylesterase/protein-glutamine glutaminase 5 Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
P42012 4.18e-05 47 24 3 137 3 spo0A Stage 0 sporulation protein A Lysinibacillus sphaericus
P72253 4.57e-05 47 30 2 110 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase of group 2 operon Rhodospirillum centenum (strain ATCC 51521 / SW)
Q47GX7 4.72e-05 47 30 2 105 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Dechloromonas aromatica (strain RCB)
Q93CB8 4.95e-05 46 31 3 102 3 mtrA DNA-binding response regulator MtrA Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
P9WGM7 5.34e-05 46 31 3 102 1 mtrA DNA-binding response regulator MtrA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM6 5.34e-05 46 31 3 102 3 mtrA DNA-binding response regulator MtrA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0A5Z5 5.34e-05 46 31 3 102 3 mtrA DNA-binding response regulator MtrA Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
A1KHB7 5.36e-05 46 33 6 120 3 mprA Response regulator MprA Mycobacterium bovis (strain BCG / Pasteur 1173P2)
Q7U0X4 5.36e-05 46 33 6 120 1 mprA Response regulator MprA Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P32967 5.53e-05 46 27 2 121 1 gacA Response regulator GacA Pseudomonas protegens (strain DSM 19095 / LMG 27888 / CFBP 6595 / CHA0)
Q9CCJ2 5.97e-05 46 31 3 102 3 mtrA DNA-binding response regulator MtrA Mycobacterium leprae (strain TN)
P59342 5.99e-05 47 25 8 221 3 barA Signal transduction histidine-protein kinase BarA Shigella flexneri
Q6LU34 7.16e-05 46 26 2 102 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Photobacterium profundum (strain SS9)
P9WGN1 7.53e-05 46 30 4 126 1 kdpE Transcriptional regulatory protein KdpE Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGN0 7.53e-05 46 30 4 126 3 kdpE Transcriptional regulatory protein KdpE Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
O78428 7.84e-05 46 32 3 111 3 ycf27 Probable transcriptional regulator ycf27 Guillardia theta
Q8Z333 8.12e-05 46 25 6 172 3 zraR Transcriptional regulatory protein ZraR Salmonella typhi
P25852 8.19e-05 46 25 6 172 1 zraR Transcriptional regulatory protein ZraR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P9WGM9 8.57e-05 45 33 6 120 1 mprA Response regulator MprA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM8 8.57e-05 45 33 6 120 3 mprA Response regulator MprA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5U123 8.57e-05 45 33 6 120 3 mprA Response regulator MprA Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
P58253 8.63e-05 46 31 3 121 3 spo0A Stage 0 sporulation protein A homolog Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
P96602 9.01e-05 45 22 1 118 3 dctR Probable C4-dicarboxylate response regulator DctR Bacillus subtilis (strain 168)
Q3IRR4 9.17e-05 46 25 4 124 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Natronomonas pharaonis (strain ATCC 35678 / DSM 2160 / CIP 103997 / JCM 8858 / NBRC 14720 / NCIMB 2260 / Gabara)
Q9I4F9 0.000102 45 28 3 117 1 phoP Two-component response regulator PhoP Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q4UU85 0.000104 46 31 5 122 1 rpfG Cyclic di-GMP phosphodiesterase response regulator RpfG Xanthomonas campestris pv. campestris (strain 8004)
A0PWB4 0.000113 45 32 4 118 3 mprA Response regulator MprA Mycobacterium ulcerans (strain Agy99)
Q7WZY4 0.000121 45 24 3 121 1 nreC Oxygen regulatory protein NreC Staphylococcus carnosus (strain TM300)
Q1D225 0.000126 45 29 1 106 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Myxococcus xanthus (strain DK1622)
Q2WAJ8 0.000128 45 28 3 114 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
P06534 0.000138 45 30 4 115 1 spo0A Stage 0 sporulation protein A Bacillus subtilis (strain 168)
Q0HKN5 0.000142 45 25 2 113 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Shewanella sp. (strain MR-4)
Q0HWY6 0.000144 45 25 2 113 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Shewanella sp. (strain MR-7)
Q2T8Y6 0.000146 45 32 3 108 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q4L8Q6 0.000158 45 25 3 122 3 nreC Oxygen regulatory protein NreC Staphylococcus haemolyticus (strain JCSC1435)
Q8ECD7 0.000168 45 25 2 113 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
P0AGA9 0.000171 44 26 2 119 3 uhpA Transcriptional regulatory protein UhpA Shigella flexneri
P0AGA6 0.000171 44 26 2 119 1 uhpA Transcriptional regulatory protein UhpA Escherichia coli (strain K12)
P0AGA7 0.000171 44 26 2 119 3 uhpA Transcriptional regulatory protein UhpA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AGA8 0.000171 44 26 2 119 3 uhpA Transcriptional regulatory protein UhpA Escherichia coli O157:H7
Q2SFY4 0.000212 45 33 0 62 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Hahella chejuensis (strain KCTC 2396)
Q2T7Z3 0.000215 45 30 1 105 3 cheB4 Protein-glutamate methylesterase/protein-glutamine glutaminase 4 Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q8P7A6 0.00022 45 33 0 59 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q4UWU6 0.00022 45 33 0 59 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Xanthomonas campestris pv. campestris (strain 8004)
P27667 0.000226 44 26 2 119 3 uhpA Transcriptional regulatory protein UhpA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P52940 0.000269 44 28 2 131 3 spo0A Stage 0 sporulation protein A homolog Clostridium pasteurianum
B0R4K1 0.000291 42 30 2 106 1 cheY Chemotaxis protein CheY Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)
Q9HXT8 0.0003 44 32 1 99 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q55890 0.000312 44 28 4 111 1 rpaA DNA-binding dual master transcriptional regulator RpaA Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q2INJ8 0.000325 44 35 6 112 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Anaeromyxobacter dehalogenans (strain 2CP-C)
Q9APD9 0.000326 44 24 9 210 3 zraR Transcriptional regulatory protein ZraR Klebsiella oxytoca
Q63J47 0.000333 44 30 1 105 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Burkholderia pseudomallei (strain K96243)
Q3JJY2 0.000333 44 30 1 105 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Burkholderia pseudomallei (strain 1710b)
Q4V2X4 0.000333 44 30 1 105 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Burkholderia mallei (strain ATCC 23344)
Q394I6 0.000357 44 30 1 93 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q00934 0.000365 44 32 4 114 1 pilR Response regulator protein PilR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q0ARY3 0.000386 44 29 3 106 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Maricaulis maris (strain MCS10)
O69730 0.00041 43 31 6 114 1 tcrX Probable transcriptional regulatory protein TcrX Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Q4L7J5 0.000457 43 29 3 122 3 vraR Response regulator protein VraR Staphylococcus haemolyticus (strain JCSC1435)
A3LP85 0.000501 43 43 4 66 3 SRR1 Stress response regulator protein 1 Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545)
Q3BR57 0.00054 43 33 0 59 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q8PIM5 0.000545 43 33 0 59 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Xanthomonas axonopodis pv. citri (strain 306)
Q2KV65 0.000577 43 28 1 106 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Bordetella avium (strain 197N)
O25408 0.000594 43 26 2 116 1 flgR Transcriptional regulatory protein FlgR Helicobacter pylori (strain ATCC 700392 / 26695)
Q8CNP9 0.000606 43 27 2 121 3 vraR Response regulator protein VraR Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HN50 0.000606 43 27 2 121 3 vraR Response regulator protein VraR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q4KHL8 0.00062 43 34 0 63 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q21ZZ9 0.000665 43 27 1 102 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Q48F23 0.000779 43 29 1 105 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q2P5Q6 0.000799 43 34 0 58 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q4ZWW3 0.000823 43 29 1 105 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Pseudomonas syringae pv. syringae (strain B728a)
Q8H7S7 0.00083 43 32 6 113 2 RR21 Two-component response regulator ORR21 Oryza sativa subsp. japonica
A2XE31 0.00083 43 32 6 113 3 RR21 Two-component response regulator ORR21 Oryza sativa subsp. indica
Q5H2V2 0.000859 43 34 0 58 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
Q8F6P9 0.001 43 27 2 110 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
P62641 0.001 43 27 2 110 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_13150
Feature type CDS
Gene btsR
Product two-component system response regulator BtsR
Location 38485 - 39198 (strand: 1)
Length 714 (nucleotides) / 237 (amino acids)

Contig

Accession ZDB_528
Length 162442 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_307
Orthogroup size 8
N. genomes 7

Actions

Genomic region

Domains

PF00072 Response regulator receiver domain
PF04397 LytTr DNA-binding domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3279 Transcription (K)
Signal transduction mechanisms (T)
KT DNA-binding response regulator, LytR/AlgR family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02477 two-component system, LytTR family, response regulator - -

Protein Sequence

MNVLIVDDEPLARENLRLLLDAYPDIHILGECTNAIDAIGKIHRLKPDVVFLDIQMPRVTGLEMVGMLDPGHRPAIVFLTAFEEYALQAFEEDAFDYLLKPVEKERLDKTLNRLRQGQIRPAETPEQTEQLRYIPCSGHNRIWLMPVEDVVYVNSRISGVFVMSAHGQEGFTELTLRTLETRTPLLRCHRQYLVNLTRLREILLGDNGQAELILSNDETIPVSRRYLRPLKEALGLI

Flanking regions ( +/- flanking 50bp)

CGGCAGGTGCGGCAGCACCGCCTGATAACTAAAAAAATGATAATGACACAATGAATGTTTTAATTGTTGATGATGAGCCACTGGCCCGGGAAAACCTGCGATTACTGCTCGATGCGTATCCTGACATCCATATCCTGGGTGAATGCACCAACGCCATTGATGCTATCGGAAAAATTCACCGCCTGAAGCCGGACGTGGTGTTTCTGGATATCCAGATGCCCCGTGTCACCGGGCTGGAAATGGTCGGTATGCTCGATCCCGGCCACCGGCCTGCGATTGTTTTTCTCACCGCCTTTGAAGAGTATGCCTTACAGGCTTTTGAGGAGGATGCGTTTGATTATCTGCTCAAACCGGTGGAAAAAGAGCGCCTGGACAAAACCCTGAACCGGCTGCGCCAGGGGCAGATCCGCCCGGCGGAGACCCCGGAACAGACAGAGCAACTGCGCTATATCCCGTGCAGCGGGCACAACCGTATCTGGCTGATGCCGGTTGAGGATGTGGTGTATGTCAATTCCCGTATCAGCGGCGTGTTTGTGATGAGCGCGCACGGCCAGGAAGGATTTACCGAGCTGACACTGCGTACTCTGGAAACCCGTACCCCGCTGCTGCGCTGCCACCGGCAGTATCTGGTCAATCTGACCCGTCTGCGGGAAATCCTGCTGGGCGATAACGGCCAGGCCGAGCTGATCCTGAGTAACGATGAAACCATTCCGGTCAGCCGCCGCTACCTCAGACCCCTGAAGGAAGCGCTGGGGCTGATTTAATACCAAAATCCGGACGCATAAAAAAAGCCCGGCAGGGATATCCCCGGCCG