Homologs in group_307

Help

7 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_08715 FBDBKF_08715 51.6 Morganella morganii S1 btsR two-component system response regulator BtsR
EHELCC_12810 EHELCC_12810 51.6 Morganella morganii S2 btsR two-component system response regulator BtsR
NLDBIP_13150 NLDBIP_13150 51.6 Morganella morganii S4 btsR two-component system response regulator BtsR
LHKJJB_13405 LHKJJB_13405 51.6 Morganella morganii S3 btsR two-component system response regulator BtsR
HKOGLL_11625 HKOGLL_11625 51.6 Morganella morganii S5 btsR two-component system response regulator BtsR
F4V73_RS09935 F4V73_RS09935 51.6 Morganella psychrotolerans btsR two-component system response regulator BtsR
PMI_RS17095 PMI_RS17095 76.5 Proteus mirabilis HI4320 btsR two-component system response regulator BtsR

Distribution of the homologs in the orthogroup group_307

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_307

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q8ZNN2 9.66e-08 49 52 1 50 3 btsR Transcriptional regulatory protein BtsR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8Z5C1 9.86e-08 49 52 1 50 3 btsR Transcriptional regulatory protein BtsR Salmonella typhi
P0AFT5 2.02e-07 48 50 1 50 1 btsR Transcriptional regulatory protein BtsR Escherichia coli (strain K12)
P0AFT6 2.02e-07 48 50 1 50 3 btsR Transcriptional regulatory protein BtsR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0DUE6 2.02e-07 48 50 1 50 3 btsR Transcriptional regulatory protein BtsR Escherichia coli O157:H7
P0DUE7 2.02e-07 48 50 1 50 4 btsR Transcriptional regulatory protein-like BtsR Enterobacteria phage VT1-Sakai
P59640 2.37e-07 48 50 1 50 3 btsR Transcriptional regulatory protein BtsR Shigella flexneri

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS17080
Feature type CDS
Gene -
Product hypothetical protein
Location 3758637 - 3758843 (strand: -1)
Length 207 (nucleotides) / 68 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_307
Orthogroup size 8
N. genomes 7

Actions

Genomic region

Protein Sequence

MLLRRRGTFSLLPPSLTIYLNNLLNPLEQERLAKTLSRLRQGNKQNIDLLSPPEERLKCIPCTRYSRI

Flanking regions ( +/- flanking 50bp)

ATCATCAACTCAATTGAATACTGAGTGAATTATATTCTTATTGATTATGAGTGCTACTACGGCGACGTGGTACATTTTCGTTATTACCGCCCTCGCTCACCATTTACCTGAACAATTTGCTTAATCCATTAGAGCAAGAGCGTTTAGCCAAAACATTAAGTCGTTTACGCCAAGGCAATAAACAAAATATTGATTTATTATCGCCACCAGAAGAACGCTTAAAGTGCATTCCTTGTACTAGGTATAGCCGTATTTAGCTAATGCCAATCGATGAAGCAGTGTTTGCTAGATCACAATTAAGCGGTGT