Homologs in group_395

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_14600 FBDBKF_14600 59.2 Morganella morganii S1 fimC P pilus assembly protein, chaperone PapD
EHELCC_15405 EHELCC_15405 59.2 Morganella morganii S2 fimC P pilus assembly protein, chaperone PapD
NLDBIP_15935 NLDBIP_15935 59.2 Morganella morganii S4 fimC P pilus assembly protein, chaperone PapD
LHKJJB_15905 LHKJJB_15905 59.2 Morganella morganii S3 fimC P pilus assembly protein, chaperone PapD
HKOGLL_15025 HKOGLL_15025 59.2 Morganella morganii S5 fimC P pilus assembly protein, chaperone PapD
PMI_RS16665 PMI_RS16665 37.8 Proteus mirabilis HI4320 - molecular chaperone

Distribution of the homologs in the orthogroup group_395

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_395

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P59590 3.53e-38 135 38 5 177 3 fimC Chaperone protein FimC Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P62609 3.67e-38 135 36 5 206 1 focC Chaperone protein FocC Escherichia coli
P62610 3.67e-38 135 36 5 206 3 focC Chaperone protein FocC Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P31697 5.31e-38 135 38 5 177 1 fimC Chaperone protein FimC Escherichia coli (strain K12)
P75856 6.99e-33 121 33 5 215 2 elfD Probable fimbrial chaperone protein ElfD Escherichia coli (strain K12)
P37923 8.94e-33 121 31 6 222 3 fimC Chaperone protein FimC Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P43661 2.68e-32 120 33 6 211 3 lpfB Chaperone protein LpfB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8X5E4 6.6e-32 119 32 5 215 2 elfD Probable fimbrial chaperone protein ElfD Escherichia coli O157:H7
Q8X5K6 3.83e-31 117 33 4 188 2 lpfB Probable fimbrial chaperone LpfB Escherichia coli O157:H7
P21646 2.62e-30 115 32 8 229 3 mrkB Chaperone protein MrkB Klebsiella pneumoniae
P77249 1.66e-29 112 33 4 180 2 sfmC Probable fimbrial chaperone SfmC Escherichia coli (strain K12)
P42914 6.04e-28 108 33 5 181 2 yraI Probable fimbrial chaperone YraI Escherichia coli (strain K12)
P77616 2.4e-26 105 34 10 238 3 yqiH Uncharacterized fimbrial chaperone YqiH Escherichia coli (strain K12)
P25402 8.52e-25 100 34 3 175 3 fanE Chaperone protein FanE Escherichia coli
P15319 1.72e-23 97 32 10 232 1 papD Chaperone protein PapD Escherichia coli
P33128 3.84e-23 96 29 11 232 1 yadV Probable fimbrial chaperone YadV Escherichia coli (strain K12)
P53520 6.61e-23 96 31 7 208 3 pmfD Chaperone protein PmfD Proteus mirabilis (strain HI4320)
P35757 6.86e-23 95 29 10 230 3 hifB Chaperone protein HifB Haemophilus influenzae
P25401 7.75e-23 95 28 5 208 1 faeE Chaperone protein FaeE Escherichia coli
Q05433 2.13e-22 95 28 5 208 3 clpE Chaperone protein ClpE Escherichia coli
P75749 3.7e-22 94 29 6 219 3 ybgP Uncharacterized fimbrial chaperone YbgP Escherichia coli (strain K12)
P77599 8.08e-22 93 30 5 198 2 yfcS Probable fimbrial chaperone YfcS Escherichia coli (strain K12)
P45991 1.4e-21 92 28 9 228 3 hifB Chaperone protein HifB Haemophilus influenzae
P53516 2.12e-20 89 30 6 180 3 afaB Chaperone protein AfaB Escherichia coli
P33409 2.2e-20 89 29 8 219 3 fimB Chaperone protein FimB/FhaD Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
P40876 4.29e-19 85 26 7 223 2 ycbF Uncharacterized fimbrial chaperone YcbF Escherichia coli (strain K12)
P33342 7.3e-19 85 29 7 223 2 yehC Probable fimbrial chaperone YehC Escherichia coli (strain K12)
P15483 5.06e-18 82 31 5 193 3 None Chaperone protein CS3-1 Escherichia coli
P46004 8.7e-18 82 29 6 207 3 aggD Chaperone protein AggD Escherichia coli
P69966 1.6e-17 82 27 8 222 3 psaB Chaperone protein PsaB Yersinia pseudotuberculosis serotype I (strain IP32953)
P69965 1.6e-17 82 27 8 222 3 psaB Chaperone protein PsaB Yersinia pestis
P33407 1.27e-16 79 28 8 222 3 myfB Chaperone protein MyfB Yersinia enterocolitica
P26926 1.87e-16 79 32 7 179 1 caf1M Chaperone protein caf1M Yersinia pestis
P46738 3.64e-16 77 29 6 180 3 nfaE Chaperone protein NfaE Escherichia coli
P33387 4.19e-12 66 26 6 216 3 sefB Chaperone protein SefB Salmonella enteritidis
P53519 1.25e-11 65 25 5 183 3 cssC Chaperone protein CssC Escherichia coli
P53518 1.79e-11 64 25 4 159 3 cssC Chaperone protein CssC Escherichia coli
P42183 0.000138 43 31 6 108 3 prsD Chaperone protein PrsD (Fragment) Escherichia coli

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS07395
Feature type CDS
Gene -
Product molecular chaperone
Location 1544786 - 1545454 (strand: -1)
Length 669 (nucleotides) / 222 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000001
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_395
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00345 Pili and flagellar-assembly chaperone, PapD N-terminal domain
PF02753 Pili assembly chaperone PapD, C-terminal domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3121 Extracellular structures (W) W P pilus assembly protein, chaperone PapD

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K07346 fimbrial chaperone protein Two-component system -

Protein Sequence

MKKNIIYFITLWMVCSQAYAGIVVGGTRFIYPQSRKMITVPVENTDSERPYLIQSWIEDEDGINKTKEFVITPVIFQLNEKKKSMFRVLLRKADLKSDRETLFWLNVRGIPATESDTENKLQVVINSKFKLFYRPDGLTEPDFNKIQYEISGRKIKILNKTPYHLTIKSININKKEHSVSDMIKPFDDLIVSANVIYEKNDIVINYISDLGGVISRPVVFNN

Flanking regions ( +/- flanking 50bp)

TACAGGGTGGTAATACGGATTGCTGCCCTGTTATATCAGATAATTTTTTTATGAAAAAAAACATCATTTATTTTATCACGTTATGGATGGTATGCAGCCAGGCATATGCGGGGATTGTGGTCGGGGGAACCCGGTTTATCTATCCTCAGAGCCGGAAAATGATCACTGTGCCGGTTGAAAATACGGATAGTGAACGACCTTACTTAATTCAGTCCTGGATTGAGGATGAAGATGGCATTAATAAAACGAAAGAATTTGTGATAACACCGGTTATATTTCAGTTAAATGAAAAAAAGAAAAGTATGTTTCGTGTTTTATTGCGTAAGGCTGATTTAAAATCAGACAGAGAAACCTTGTTCTGGCTGAACGTACGGGGTATTCCTGCAACAGAATCAGATACTGAAAATAAATTACAGGTTGTTATTAATTCTAAGTTTAAATTGTTTTACCGTCCGGATGGATTAACAGAGCCTGATTTTAATAAAATACAGTATGAGATATCAGGCAGGAAAATAAAAATACTGAATAAAACACCCTATCATCTAACAATAAAGAGCATTAATATAAACAAAAAAGAACATTCTGTTTCCGATATGATTAAGCCCTTTGATGATTTGATTGTTTCAGCTAATGTCATTTATGAGAAAAATGATATTGTTATTAATTATATTAGTGATCTTGGCGGGGTAATCAGCAGGCCGGTGGTTTTCAATAATTAAAAAATAACTGCGGATATATGTATTTAAAAAAAACTCATCTTATATTTATG