Homologs in group_1355

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_08395 FBDBKF_08395 72.2 Morganella morganii S1 yigL sugar/pyridoxal phosphate phosphatase YigL
EHELCC_13130 EHELCC_13130 72.2 Morganella morganii S2 yigL sugar/pyridoxal phosphate phosphatase YigL
NLDBIP_13470 NLDBIP_13470 72.2 Morganella morganii S4 yigL sugar/pyridoxal phosphate phosphatase YigL
LHKJJB_13085 LHKJJB_13085 72.2 Morganella morganii S3 yigL sugar/pyridoxal phosphate phosphatase YigL
HKOGLL_11945 HKOGLL_11945 72.2 Morganella morganii S5 yigL sugar/pyridoxal phosphate phosphatase YigL
F4V73_RS09595 F4V73_RS09595 70.3 Morganella psychrotolerans yigL sugar/pyridoxal phosphate phosphatase YigL

Distribution of the homologs in the orthogroup group_1355

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1355

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P27848 6.49e-123 353 63 0 264 1 yigL Pyridoxal phosphate phosphatase YigL Escherichia coli (strain K12)
Q8X8L6 4.92e-122 351 62 0 264 3 yigL Pyridoxal phosphate phosphatase YigL Escherichia coli O157:H7
Q89B25 8.3e-80 244 46 0 264 3 bbp_030 Putative phosphatase bbp_030 Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q8KA73 1.5e-77 239 46 0 262 3 BUsg_029 Putative phosphatase BUsg_029 Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
P57140 2.12e-71 223 42 0 264 3 BU028/BU029 Putative phosphatase BU028/BU029 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
P44771 6.41e-71 222 44 1 261 3 HI_0597 Putative phosphatase HI_0597 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A7MFJ6 1.97e-58 190 38 2 260 3 cof HMP-PP phosphatase Cronobacter sakazakii (strain ATCC BAA-894)
Q83M49 1.29e-55 182 39 2 260 3 cof HMP-PP phosphatase Shigella flexneri
Q0T7D7 1.29e-55 182 39 2 260 3 cof HMP-PP phosphatase Shigella flexneri serotype 5b (strain 8401)
Q325F5 3.13e-55 181 39 2 260 3 cof HMP-PP phosphatase Shigella boydii serotype 4 (strain Sb227)
B7LMD3 3.31e-55 181 39 2 260 3 cof HMP-PP phosphatase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B7N900 4.72e-55 181 39 2 260 3 cof HMP-PP phosphatase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
B7M3T9 4.72e-55 181 39 2 260 3 cof HMP-PP phosphatase Escherichia coli O8 (strain IAI1)
Q8FKA2 6.32e-55 181 39 2 260 3 cof HMP-PP phosphatase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
B5Z3V4 6.32e-55 181 38 2 260 3 cof HMP-PP phosphatase Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8XE50 6.32e-55 181 38 2 260 3 cof HMP-PP phosphatase Escherichia coli O157:H7
Q3Z4V2 6.96e-55 181 39 2 260 3 cof HMP-PP phosphatase Shigella sonnei (strain Ss046)
B2U4Q1 6.96e-55 181 39 2 260 3 cof HMP-PP phosphatase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q1RF89 6.96e-55 181 39 2 260 3 cof HMP-PP phosphatase Escherichia coli (strain UTI89 / UPEC)
B1LJK3 6.96e-55 181 39 2 260 3 cof HMP-PP phosphatase Escherichia coli (strain SMS-3-5 / SECEC)
B6HZQ3 6.96e-55 181 39 2 260 3 cof HMP-PP phosphatase Escherichia coli (strain SE11)
Q0TKJ5 6.96e-55 181 39 2 260 3 cof HMP-PP phosphatase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1A8B5 6.96e-55 181 39 2 260 3 cof HMP-PP phosphatase Escherichia coli O1:K1 / APEC
A7ZXA4 6.96e-55 181 39 2 260 3 cof HMP-PP phosphatase Escherichia coli O9:H4 (strain HS)
B7NJ48 6.96e-55 181 39 2 260 3 cof HMP-PP phosphatase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B7MDA5 6.96e-55 181 39 2 260 3 cof HMP-PP phosphatase Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UJR9 6.96e-55 181 39 2 260 3 cof HMP-PP phosphatase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZIK4 6.96e-55 181 39 2 260 3 cof HMP-PP phosphatase Escherichia coli O139:H28 (strain E24377A / ETEC)
P46891 8.55e-55 181 39 2 260 1 cof HMP-PP phosphatase Escherichia coli (strain K12)
B1XFN4 8.55e-55 181 39 2 260 3 cof HMP-PP phosphatase Escherichia coli (strain K12 / DH10B)
C4ZTK3 8.55e-55 181 39 2 260 3 cof HMP-PP phosphatase Escherichia coli (strain K12 / MC4100 / BW2952)
B7MQG2 2.66e-54 179 38 2 260 3 cof HMP-PP phosphatase Escherichia coli O81 (strain ED1a)
B7L683 4.27e-54 179 38 2 260 3 cof HMP-PP phosphatase Escherichia coli (strain 55989 / EAEC)
A4TPD3 1.31e-53 177 36 2 260 3 cof HMP-PP phosphatase Yersinia pestis (strain Pestoides F)
Q1CL56 1.31e-53 177 36 2 260 3 cof HMP-PP phosphatase Yersinia pestis bv. Antiqua (strain Nepal516)
A9QZP3 1.31e-53 177 36 2 260 3 cof HMP-PP phosphatase Yersinia pestis bv. Antiqua (strain Angola)
Q7CK25 1.31e-53 177 36 2 260 3 cof HMP-PP phosphatase Yersinia pestis
Q1C4L7 1.31e-53 177 36 2 260 3 cof HMP-PP phosphatase Yersinia pestis bv. Antiqua (strain Antiqua)
A8AK07 1.56e-53 177 36 2 260 3 cof HMP-PP phosphatase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
A9MM14 1.93e-53 177 36 2 260 3 cof HMP-PP phosphatase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q8Z8U7 4.69e-53 176 36 2 260 3 cof HMP-PP phosphatase Salmonella typhi
Q8ZRB6 4.95e-53 176 36 2 260 3 cof HMP-PP phosphatase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B5BD74 4.95e-53 176 36 2 260 3 cof HMP-PP phosphatase Salmonella paratyphi A (strain AKU_12601)
A9MWC0 4.95e-53 176 36 2 260 3 cof HMP-PP phosphatase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PFM4 4.95e-53 176 36 2 260 3 cof HMP-PP phosphatase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4T9F2 4.95e-53 176 36 2 260 3 cof HMP-PP phosphatase Salmonella heidelberg (strain SL476)
B5R6V8 4.95e-53 176 36 2 260 3 cof HMP-PP phosphatase Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QU47 4.95e-53 176 36 2 260 3 cof HMP-PP phosphatase Salmonella enteritidis PT4 (strain P125109)
B5FKW1 4.95e-53 176 36 2 260 3 cof HMP-PP phosphatase Salmonella dublin (strain CT_02021853)
B4SWV0 5.22e-53 176 36 2 260 3 cof HMP-PP phosphatase Salmonella newport (strain SL254)
A4W7B7 5.45e-53 176 37 2 260 3 cof HMP-PP phosphatase Enterobacter sp. (strain 638)
B5EXJ7 8.95e-53 175 36 2 260 3 cof HMP-PP phosphatase Salmonella agona (strain SL483)
B1JHR2 1.19e-52 175 36 2 260 3 cof HMP-PP phosphatase Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
A7FLB5 1.19e-52 175 36 2 260 3 cof HMP-PP phosphatase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
B4TMD5 1.2e-52 175 36 2 260 3 cof HMP-PP phosphatase Salmonella schwarzengrund (strain CVM19633)
Q57SA6 1.2e-52 175 36 2 260 3 cof HMP-PP phosphatase Salmonella choleraesuis (strain SC-B67)
A1JNL2 2.4e-52 174 36 2 261 3 cof HMP-PP phosphatase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
A8GAR8 2.88e-52 174 36 4 264 3 cof HMP-PP phosphatase Serratia proteamaculans (strain 568)
Q66DS5 3.54e-52 174 36 2 260 3 cof HMP-PP phosphatase Yersinia pseudotuberculosis serotype I (strain IP32953)
B2K6W6 1.32e-51 172 35 2 260 3 cof HMP-PP phosphatase Yersinia pseudotuberculosis serotype IB (strain PB1/+)
B5Y0T3 8.74e-51 170 35 2 260 3 cof HMP-PP phosphatase Klebsiella pneumoniae (strain 342)
B1IZE7 8.04e-49 164 38 2 239 3 cof HMP-PP phosphatase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A6T5I9 9.65e-49 165 34 2 260 3 cof HMP-PP phosphatase Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
P21829 2.11e-24 101 27 6 274 1 ybhA Pyridoxal phosphate phosphatase YbhA Escherichia coli (strain K12)
P94592 1.18e-22 97 26 7 285 1 ywpJ Phosphatase YwpJ Bacillus subtilis (strain 168)
Q32JB1 1.85e-21 90 39 1 122 5 cof Putative HMP-PP phosphatase Shigella dysenteriae serotype 1 (strain Sd197)
P42962 2.75e-17 82 24 6 258 1 ycsE 5-amino-6-(5-phospho-D-ribitylamino)uracil phosphatase YcsE Bacillus subtilis (strain 168)
Q9UTA6 4.29e-17 82 27 8 280 1 SPAC25B8.12c Uncharacterized hydrolase C25B8.12c Schizosaccharomyces pombe (strain 972 / ATCC 24843)
P44447 7.82e-15 75 25 5 267 1 HI_0003 Putative phosphatase HI_0003 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P54947 9.86e-15 75 27 10 255 3 yxeH Putative phosphatase YxeH Bacillus subtilis (strain 168)
Q5XD45 2.93e-14 73 28 8 269 1 M6_Spy0533 Putative phosphatase M6_Spy0533 Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P96741 7.17e-13 70 26 10 286 1 ywtE 5-amino-6-(5-phospho-D-ribitylamino)uracil phosphatase YwtE Bacillus subtilis (strain 168)
P0A8Y7 1.53e-12 69 27 9 274 3 yidA Sugar phosphatase YidA Shigella flexneri
P0A8Y5 1.53e-12 69 27 9 274 1 yidA Sugar phosphatase YidA Escherichia coli (strain K12)
P0A8Y6 1.53e-12 69 27 9 274 3 yidA Sugar phosphatase YidA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P53661 2.17e-12 68 27 10 276 3 MCAP_0732 Putative phosphatase MCAP_0732 Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154)
O94314 2.82e-12 68 25 9 278 3 SPBC215.10 Uncharacterized hydrolase C215.10 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q8L5Z4 6.94e-11 65 24 9 286 1 YBEY Endoribonuclease YBEY, chloroplastic Arabidopsis thaliana
P70947 1.83e-10 63 25 9 277 1 yitU 5-amino-6-(5-phospho-D-ribitylamino)uracil phosphatase YitU Bacillus subtilis (strain 168)
P75360 5.3e-10 62 27 9 241 3 MPN_427 Putative phosphatase MPN_427 Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
Q45494 9.3e-10 61 24 11 277 3 ykrA Putative phosphatase YkrA Bacillus subtilis (strain 168)
P75399 3.82e-09 59 25 5 251 3 MPN_383 Putative phosphatase MPN_383 Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
P43051 4.89e-09 59 24 8 255 3 None Putative phosphatase in upp 3'region Metamycoplasma hominis
P75809 7.42e-09 58 22 6 238 1 ybjI 5-amino-6-(5-phospho-D-ribitylamino)uracil phosphatase YbjI Escherichia coli (strain K12)
P75401 2.23e-08 57 26 8 252 3 MPN_381 Putative phosphatase MPN_381 Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
P47507 3.03e-08 57 26 6 253 3 MG265 Putative phosphatase MG265 Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
O07539 5.17e-08 56 22 8 292 1 yhaX Stress response protein YhaX Bacillus subtilis (strain 168)
A3CWU5 9.25e-08 55 26 9 239 3 Memar_1919 Phosphoglycolate phosphatase Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1)
Q2FU45 7.28e-06 49 22 5 242 3 Mhun_2939 Phosphoglycolate phosphatase Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1)
C0QRP9 1.46e-05 48 25 5 228 1 gpgP Glucosyl-3-phosphoglycerate/mannosyl-3-phosphoglycerate phosphatase Persephonella marina (strain DSM 14350 / EX-H1)
P21878 2.34e-05 45 38 0 57 3 None Uncharacterized protein in pdhA 5'region (Fragment) Geobacillus stearothermophilus
P47505 0.000323 45 25 8 255 3 MG263 Putative phosphatase MG263 Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
Q8PZN6 0.000423 44 37 0 53 3 MM_0456 Phosphoglycolate phosphatase Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q12UG6 0.000624 43 42 0 54 3 Mbur_2034 Phosphoglycolate phosphatase Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS16650
Feature type CDS
Gene yigL
Product sugar/pyridoxal phosphate phosphatase YigL
Location 3670106 - 3670906 (strand: 1)
Length 801 (nucleotides) / 266 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_1355
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF08282 haloacid dehalogenase-like hydrolase

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0561 Coenzyme transport and metabolism (H)
General function prediction only (R)		 HR Hydroxymethylpyrimidine pyrophosphatase and other HAD family phosphatases

Kegg Ortholog Annotation(s)

Protein Sequence

MYSIVASDLDGTLLSPNHLLTPYTKETLHLLIEKGIHFVFATGRHHIDVAQIRDGLGIDAYMITSNGARVHNTQGTLIFSQDLEPEIVYDLALMVFDHPDIATNIYSSDDWYINKETPELKEFFKESVFNYRLFEKTGFPTTQVCKVFFTSEDHELLVELEKKINQRWGNKINASFSLRNCLEIMAGGVSKGEALQKVAKLMQHSVKDAIAFGDGMNDKEMLQMAGKGCIMQNAHQLLKDLLPDMEVIGSNVDDAVAHYLRKLYQV

Flanking regions ( +/- flanking 50bp)

TTGAAATCTGTGAGTTTTATGATAAGCATTTATTTTAATCAGGAATGTGTATGTATTCGATAGTTGCTTCTGATCTTGATGGCACCTTGTTATCACCTAACCACTTATTAACTCCCTATACCAAAGAAACGTTACATCTGCTTATTGAAAAAGGGATCCATTTTGTGTTTGCCACAGGACGTCATCATATCGATGTGGCACAAATTCGTGATGGGCTTGGTATTGACGCGTATATGATCACTTCAAATGGGGCTCGAGTACACAATACGCAAGGCACTCTTATTTTCAGTCAAGATCTTGAACCTGAAATCGTTTATGACTTAGCCCTAATGGTGTTTGATCACCCAGATATTGCAACGAATATTTATAGCAGTGATGACTGGTATATCAATAAAGAAACGCCTGAATTAAAAGAATTTTTTAAAGAATCGGTATTTAATTACCGTCTATTTGAGAAAACAGGCTTCCCAACAACGCAGGTGTGCAAAGTCTTTTTTACCTCAGAAGATCATGAATTGTTAGTTGAGTTAGAAAAGAAAATTAATCAACGTTGGGGCAATAAAATTAACGCAAGTTTTTCGTTGCGTAATTGCCTAGAAATTATGGCGGGTGGGGTATCAAAAGGAGAGGCACTACAAAAAGTCGCTAAGTTGATGCAACATTCAGTAAAAGATGCCATTGCATTTGGTGATGGTATGAATGATAAAGAGATGCTACAGATGGCGGGTAAAGGCTGCATTATGCAAAATGCCCACCAGCTACTAAAAGATCTATTACCGGATATGGAAGTGATTGGCTCAAATGTTGATGATGCTGTTGCACACTATTTACGTAAGTTGTATCAGGTTTAATCACAACCAATGGGATAAATTAAAAGGCGGATAATACTTCCGCCTTTTAG