Homologs in group_1377

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_08165 FBDBKF_08165 55.1 Morganella morganii S1 ilvM acetolactate synthase 2 small subunit
EHELCC_13365 EHELCC_13365 55.1 Morganella morganii S2 ilvM acetolactate synthase 2 small subunit
NLDBIP_13700 NLDBIP_13700 55.1 Morganella morganii S4 ilvM acetolactate synthase 2 small subunit
LHKJJB_12855 LHKJJB_12855 55.1 Morganella morganii S3 ilvM acetolactate synthase 2 small subunit
HKOGLL_12175 HKOGLL_12175 55.1 Morganella morganii S5 ilvM acetolactate synthase 2 small subunit
F4V73_RS18695 F4V73_RS18695 53.9 Morganella psychrotolerans ilvM acetolactate synthase 2 small subunit

Distribution of the homologs in the orthogroup group_1377

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1377

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0ADG3 2.9e-25 92 58 1 75 3 ilvM Acetolactate synthase isozyme 2 small subunit Shigella flexneri
P0ADG1 2.9e-25 92 58 1 75 1 ilvM Acetolactate synthase isozyme 2 small subunit Escherichia coli (strain K12)
P0ADG2 2.9e-25 92 58 1 75 3 ilvM Acetolactate synthase isozyme 2 small subunit Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
O05031 4.08e-07 49 46 1 54 5 HI_0737 Putative uncharacterized protein HI_0737 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS16405
Feature type CDS
Gene ilvM
Product acetolactate synthase 2 small subunit
Location 3617593 - 3617871 (strand: 1)
Length 279 (nucleotides) / 92 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_1377
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF13710 ACT domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3978 Amino acid transport and metabolism (E) E Acetolactate synthase small subunit, contains ACT domain

Kegg Ortholog Annotation(s)

Protein Sequence

MNQHNITIEARFCPEILERILRVIRHRGFHICSMNMNITESNYINLALTVSSQRPVDLLCSQLTKLADVAGIQVLHQQQKEKLQFISALSAM

Flanking regions ( +/- flanking 50bp)

CCTTTAGTCCCGCCGGGCGCAAGCAATGATGAGATGATGGAGAAATCAAAATGAACCAACACAATATCACAATTGAAGCCCGTTTTTGTCCAGAGATCTTAGAACGTATCTTGAGAGTTATCCGCCACCGTGGTTTTCATATATGCTCAATGAATATGAATATCACAGAAAGTAACTATATTAATTTAGCTCTGACTGTGAGCAGTCAACGACCTGTTGATCTTTTATGTAGCCAGTTAACAAAGTTAGCTGATGTTGCAGGTATTCAGGTCTTACATCAACAACAAAAAGAAAAATTACAATTCATAAGTGCACTTAGTGCCATGTAAGGATAGAAGAATGACAAAGCAAGCTGATTATATTTGGTTTAACGGTGAAA