Homologs in group_1319

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_08165 FBDBKF_08165 100.0 Morganella morganii S1 ilvM acetolactate synthase 2 small subunit
EHELCC_13365 EHELCC_13365 100.0 Morganella morganii S2 ilvM acetolactate synthase 2 small subunit
NLDBIP_13700 NLDBIP_13700 100.0 Morganella morganii S4 ilvM acetolactate synthase 2 small subunit
LHKJJB_12855 LHKJJB_12855 100.0 Morganella morganii S3 ilvM acetolactate synthase 2 small subunit
F4V73_RS18695 F4V73_RS18695 87.0 Morganella psychrotolerans ilvM acetolactate synthase 2 small subunit
PMI_RS16405 PMI_RS16405 55.1 Proteus mirabilis HI4320 ilvM acetolactate synthase 2 small subunit

Distribution of the homologs in the orthogroup group_1319

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1319

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0ADG3 6.31e-25 92 56 1 86 3 ilvM Acetolactate synthase isozyme 2 small subunit Shigella flexneri
P0ADG1 6.31e-25 92 56 1 86 1 ilvM Acetolactate synthase isozyme 2 small subunit Escherichia coli (strain K12)
P0ADG2 6.31e-25 92 56 1 86 3 ilvM Acetolactate synthase isozyme 2 small subunit Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
O05031 0.00013 42 40 2 70 5 HI_0737 Putative uncharacterized protein HI_0737 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_12175
Feature type CDS
Gene ilvM
Product acetolactate synthase 2 small subunit
Location 156442 - 156720 (strand: -1)
Length 279 (nucleotides) / 92 (amino acids)

Contig

Accession ZDB_689
Length 162442 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1319
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF13710 ACT domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3978 Amino acid transport and metabolism (E) E Acetolactate synthase small subunit, contains ACT domain

Kegg Ortholog Annotation(s)

Protein Sequence

MMQHQLAIQARSCPEILERVLRVVRHRGFNVCAMKMDLAKGSEGDNVNIELTVSSLRPPALLCTQLVKLADVADVEVLTKNTQNYQHISCAV

Flanking regions ( +/- flanking 50bp)

CCATTAGTACCGCCGGGAGCGGGTAACGAACATATGTTGGAGAGCTCATTATGATGCAGCATCAGTTAGCAATTCAGGCACGTTCATGCCCGGAAATCCTGGAACGGGTTCTGCGTGTTGTGCGCCACCGCGGATTTAACGTCTGTGCCATGAAAATGGATCTGGCGAAAGGTTCCGAAGGTGATAATGTAAACATTGAGTTAACAGTTTCAAGCCTGCGGCCGCCGGCCCTGCTCTGTACACAGTTAGTTAAGCTGGCGGATGTGGCGGATGTCGAAGTTCTCACAAAAAATACACAAAATTATCAACACATTAGCTGTGCAGTATAAAGGAAAATTACAATGACAAAAAAAGCTGATTTTATTTGGTTCAATGATGA