Homologs in group_2397

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_19065 FBDBKF_19065 77.8 Morganella morganii S1 tsaC L-threonylcarbamoyladenylate synthase type 1 TsaC
EHELCC_18810 EHELCC_18810 77.8 Morganella morganii S2 tsaC L-threonylcarbamoyladenylate synthase type 1 TsaC
NLDBIP_18825 NLDBIP_18825 77.8 Morganella morganii S4 tsaC L-threonylcarbamoyladenylate synthase type 1 TsaC
LHKJJB_18680 LHKJJB_18680 77.8 Morganella morganii S3 tsaC L-threonylcarbamoyladenylate synthase type 1 TsaC
HKOGLL_18415 HKOGLL_18415 77.8 Morganella morganii S5 tsaC L-threonylcarbamoyladenylate synthase type 1 TsaC
F4V73_RS19100 F4V73_RS19100 75.1 Morganella psychrotolerans tsaC L-threonylcarbamoyladenylate synthase type 1 TsaC

Distribution of the homologs in the orthogroup group_2397

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2397

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q7MYI5 3.9e-101 292 70 0 189 3 tsaC Threonylcarbamoyl-AMP synthase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q3YWX6 2.22e-97 283 75 0 177 3 tsaC Threonylcarbamoyl-AMP synthase Shigella sonnei (strain Ss046)
B2U2Q0 2.22e-97 283 75 0 177 3 tsaC Threonylcarbamoyl-AMP synthase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q1R650 2.22e-97 283 75 0 177 3 tsaC Threonylcarbamoyl-AMP synthase Escherichia coli (strain UTI89 / UPEC)
B1LGN9 2.22e-97 283 75 0 177 3 tsaC Threonylcarbamoyl-AMP synthase Escherichia coli (strain SMS-3-5 / SECEC)
Q0TCH9 2.22e-97 283 75 0 177 3 tsaC Threonylcarbamoyl-AMP synthase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AGH4 2.22e-97 283 75 0 177 3 tsaC Threonylcarbamoyl-AMP synthase Escherichia coli O1:K1 / APEC
A7ZSH1 2.22e-97 283 75 0 177 3 tsaC Threonylcarbamoyl-AMP synthase Escherichia coli O139:H28 (strain E24377A / ETEC)
Q31VZ4 2.32e-97 283 75 0 177 3 tsaC Threonylcarbamoyl-AMP synthase Shigella boydii serotype 4 (strain Sb227)
Q0T019 2.51e-97 283 75 0 177 3 tsaC Threonylcarbamoyl-AMP synthase Shigella flexneri serotype 5b (strain 8401)
Q8X8F8 3.48e-97 282 75 0 177 3 tsaC Threonylcarbamoyl-AMP synthase Escherichia coli O157:H7
P45748 3.64e-97 282 75 0 177 1 tsaC Threonylcarbamoyl-AMP synthase Escherichia coli (strain K12)
B1IQ17 3.64e-97 282 75 0 177 3 tsaC Threonylcarbamoyl-AMP synthase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A8A587 3.64e-97 282 75 0 177 3 tsaC Threonylcarbamoyl-AMP synthase Escherichia coli O9:H4 (strain HS)
B1X6D5 3.64e-97 282 75 0 177 3 tsaC Threonylcarbamoyl-AMP synthase Escherichia coli (strain K12 / DH10B)
Q8FD17 9.98e-97 281 74 0 177 3 tsaC Threonylcarbamoyl-AMP synthase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q32B67 2.42e-96 280 74 0 177 3 tsaC Threonylcarbamoyl-AMP synthase Shigella dysenteriae serotype 1 (strain Sd197)
Q83JD1 4.58e-96 280 74 0 177 3 tsaC Threonylcarbamoyl-AMP synthase Shigella flexneri
A8AQH7 8e-96 279 74 0 177 3 tsaC Threonylcarbamoyl-AMP synthase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
A7MPF3 1.56e-95 278 69 0 188 3 tsaC Threonylcarbamoyl-AMP synthase Cronobacter sakazakii (strain ATCC BAA-894)
A9MN84 5.55e-94 274 72 0 177 3 tsaC Threonylcarbamoyl-AMP synthase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
A6TET6 5.48e-93 271 67 1 190 3 tsaC Threonylcarbamoyl-AMP synthase Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Q8Z1W6 7.53e-93 271 67 1 190 3 tsaC Threonylcarbamoyl-AMP synthase Salmonella typhi
Q8ZLN0 2.51e-92 270 68 2 191 3 tsaC Threonylcarbamoyl-AMP synthase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
A9N8A7 3.69e-92 270 71 0 177 3 tsaC Threonylcarbamoyl-AMP synthase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q57J68 3.69e-92 270 71 0 177 3 tsaC Threonylcarbamoyl-AMP synthase Salmonella choleraesuis (strain SC-B67)
A4WF91 6.31e-92 269 70 0 177 3 tsaC Threonylcarbamoyl-AMP synthase Enterobacter sp. (strain 638)
Q5PIS8 8.03e-92 269 67 2 191 3 tsaC Threonylcarbamoyl-AMP synthase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
A8GKG1 8.29e-92 269 68 0 189 3 tsaC Threonylcarbamoyl-AMP synthase Serratia proteamaculans (strain 568)
A1JRY6 1.43e-90 265 66 0 187 3 tsaC Threonylcarbamoyl-AMP synthase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
B1JJI2 6.33e-85 251 66 0 178 3 tsaC Threonylcarbamoyl-AMP synthase Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q664V8 6.33e-85 251 66 0 178 3 tsaC Threonylcarbamoyl-AMP synthase Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TH27 6.33e-85 251 66 0 178 3 tsaC Threonylcarbamoyl-AMP synthase Yersinia pestis (strain Pestoides F)
Q1CCY0 6.33e-85 251 66 0 178 3 tsaC Threonylcarbamoyl-AMP synthase Yersinia pestis bv. Antiqua (strain Nepal516)
A9R933 6.33e-85 251 66 0 178 3 tsaC Threonylcarbamoyl-AMP synthase Yersinia pestis bv. Antiqua (strain Angola)
Q74XX5 6.33e-85 251 66 0 178 3 tsaC Threonylcarbamoyl-AMP synthase Yersinia pestis
B2K500 6.33e-85 251 66 0 178 3 tsaC Threonylcarbamoyl-AMP synthase Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C2Y3 6.33e-85 251 66 0 178 3 tsaC Threonylcarbamoyl-AMP synthase Yersinia pestis bv. Antiqua (strain Antiqua)
A7FNJ8 6.33e-85 251 66 0 178 3 tsaC Threonylcarbamoyl-AMP synthase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A7N129 5.82e-81 241 60 1 179 3 tsaC Threonylcarbamoyl-AMP synthase Vibrio campbellii (strain ATCC BAA-1116)
Q6LLJ9 1.86e-80 240 60 1 179 3 tsaC Threonylcarbamoyl-AMP synthase Photobacterium profundum (strain SS9)
Q87KE2 1.21e-78 235 59 1 179 3 tsaC Threonylcarbamoyl-AMP synthase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q1LT55 2.87e-76 229 59 0 178 3 tsaC Threonylcarbamoyl-AMP synthase Baumannia cicadellinicola subsp. Homalodisca coagulata
Q5E1R5 3.19e-74 224 59 1 181 3 tsaC Threonylcarbamoyl-AMP synthase Aliivibrio fischeri (strain ATCC 700601 / ES114)
A0KEX6 4.58e-74 224 62 1 176 3 tsaC Threonylcarbamoyl-AMP synthase Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q2NQQ7 5.16e-74 224 63 0 179 3 tsaC Threonylcarbamoyl-AMP synthase Sodalis glossinidius (strain morsitans)
Q9KVT5 1.59e-73 222 56 1 178 3 tsaC Threonylcarbamoyl-AMP synthase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F4C5 1.59e-73 222 56 1 178 3 tsaC Threonylcarbamoyl-AMP synthase Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
A4ST51 1.44e-71 217 60 1 176 3 tsaC Threonylcarbamoyl-AMP synthase Aeromonas salmonicida (strain A449)
Q7MGL3 3.07e-71 216 55 1 179 3 tsaC Threonylcarbamoyl-AMP synthase Vibrio vulnificus (strain YJ016)
Q8DDD6 3.07e-71 216 55 1 179 3 tsaC Threonylcarbamoyl-AMP synthase Vibrio vulnificus (strain CMCP6)
Q493I0 9.18e-70 213 53 0 183 3 tsaC Threonylcarbamoyl-AMP synthase Blochmanniella pennsylvanica (strain BPEN)
Q9CLG4 2.9e-69 211 56 0 178 3 tsaC Threonylcarbamoyl-AMP synthase Pasteurella multocida (strain Pm70)
P44807 8.28e-69 210 55 0 178 1 tsaC Threonylcarbamoyl-AMP synthase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UHE9 7.96e-68 207 55 0 178 3 tsaC Threonylcarbamoyl-AMP synthase Haemophilus influenzae (strain PittGG)
A5UE77 5.39e-67 206 54 0 178 3 tsaC Threonylcarbamoyl-AMP synthase Haemophilus influenzae (strain PittEE)
Q15ZX7 7.15e-67 205 53 0 169 3 tsaC Threonylcarbamoyl-AMP synthase Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q4QMR0 1.36e-66 204 53 0 178 3 tsaC Threonylcarbamoyl-AMP synthase Haemophilus influenzae (strain 86-028NP)
Q3IDH7 3.26e-66 204 54 1 176 3 tsaC Threonylcarbamoyl-AMP synthase Pseudoalteromonas translucida (strain TAC 125)
Q7VQB9 3.72e-66 204 51 0 177 3 tsaC Threonylcarbamoyl-AMP synthase Blochmanniella floridana
A6VL69 5.59e-66 203 55 0 178 3 tsaC Threonylcarbamoyl-AMP synthase Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
P57561 1.21e-64 199 50 0 172 3 tsaC Threonylcarbamoyl-AMP synthase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B1KCX0 4.09e-64 198 52 1 175 3 tsaC Threonylcarbamoyl-AMP synthase Shewanella woodyi (strain ATCC 51908 / MS32)
Q65WC1 2.28e-61 191 50 0 178 3 tsaC Threonylcarbamoyl-AMP synthase Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q8K977 2.76e-61 191 48 0 175 3 tsaC Threonylcarbamoyl-AMP synthase Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
B3PGZ1 3.63e-61 191 49 2 185 3 tsaC Threonylcarbamoyl-AMP synthase Cellvibrio japonicus (strain Ueda107)
Q7VNS3 5.35e-60 188 47 1 189 3 tsaC Threonylcarbamoyl-AMP synthase Haemophilus ducreyi (strain 35000HP / ATCC 700724)
A8FP81 8.46e-60 187 48 1 179 3 tsaC Threonylcarbamoyl-AMP synthase Shewanella sediminis (strain HAW-EB3)
Q8P4F2 2.83e-59 186 48 1 183 3 tsaC Threonylcarbamoyl-AMP synthase Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RWR5 2.83e-59 186 48 1 183 3 tsaC Threonylcarbamoyl-AMP synthase Xanthomonas campestris pv. campestris (strain B100)
Q4UQ07 2.83e-59 186 48 1 183 3 tsaC Threonylcarbamoyl-AMP synthase Xanthomonas campestris pv. campestris (strain 8004)
A3QJE8 3.69e-59 186 49 1 177 3 tsaC Threonylcarbamoyl-AMP synthase Shewanella loihica (strain ATCC BAA-1088 / PV-4)
Q3BNJ9 9.31e-59 185 47 1 177 3 tsaC Threonylcarbamoyl-AMP synthase Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
A1RDY7 1.66e-58 184 51 1 173 3 tsaC Threonylcarbamoyl-AMP synthase Shewanella sp. (strain W3-18-1)
A4Y1D2 1.66e-58 184 51 1 173 3 tsaC Threonylcarbamoyl-AMP synthase Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
A9KUA7 2.62e-58 184 51 1 170 3 tsaC Threonylcarbamoyl-AMP synthase Shewanella baltica (strain OS195)
Q5H5D8 2.86e-58 184 46 1 177 3 tsaC Threonylcarbamoyl-AMP synthase Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
B2SL46 2.86e-58 184 46 1 177 3 tsaC Threonylcarbamoyl-AMP synthase Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q2P833 2.86e-58 184 46 1 177 3 tsaC Threonylcarbamoyl-AMP synthase Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
B0UWV9 5.08e-58 183 48 0 178 3 tsaC Threonylcarbamoyl-AMP synthase Histophilus somni (strain 2336)
Q0I1B6 5.42e-58 182 48 0 178 3 tsaC Threonylcarbamoyl-AMP synthase Histophilus somni (strain 129Pt)
Q8EKQ3 6.01e-58 183 49 1 181 3 tsaC Threonylcarbamoyl-AMP synthase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
A1S1K5 6.56e-58 182 51 1 175 3 tsaC Threonylcarbamoyl-AMP synthase Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
A6WHB6 9.5e-58 182 51 1 170 3 tsaC Threonylcarbamoyl-AMP synthase Shewanella baltica (strain OS185)
A3CYL0 9.5e-58 182 51 1 170 3 tsaC Threonylcarbamoyl-AMP synthase Shewanella baltica (strain OS155 / ATCC BAA-1091)
Q8PG13 2.54e-57 181 47 1 177 3 tsaC Threonylcarbamoyl-AMP synthase Xanthomonas axonopodis pv. citri (strain 306)
A4VFI1 3.38e-57 181 51 3 177 3 tsaC Threonylcarbamoyl-AMP synthase Stutzerimonas stutzeri (strain A1501)
B0BQ80 3.73e-57 181 51 0 178 3 tsaC Threonylcarbamoyl-AMP synthase Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B3GY27 3.73e-57 181 51 0 178 3 tsaC Threonylcarbamoyl-AMP synthase Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
Q0I0R7 5.75e-57 180 49 1 179 3 tsaC Threonylcarbamoyl-AMP synthase Shewanella sp. (strain MR-7)
Q0HPA1 5.75e-57 180 49 1 179 3 tsaC Threonylcarbamoyl-AMP synthase Shewanella sp. (strain MR-4)
A0KR66 6.92e-57 180 49 1 179 3 tsaC Threonylcarbamoyl-AMP synthase Shewanella sp. (strain ANA-3)
Q8D257 9.51e-57 180 45 0 178 3 tsaC Threonylcarbamoyl-AMP synthase Wigglesworthia glossinidia brevipalpis
Q08A23 1.41e-56 179 47 1 181 3 tsaC Threonylcarbamoyl-AMP synthase Shewanella frigidimarina (strain NCIMB 400)
B0TLD6 1.47e-56 179 49 2 187 3 tsaC Threonylcarbamoyl-AMP synthase Shewanella halifaxensis (strain HAW-EB4)
A8GYH9 2.59e-56 179 50 1 177 3 tsaC Threonylcarbamoyl-AMP synthase Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
A3N1E4 2.72e-56 178 50 0 178 3 tsaC Threonylcarbamoyl-AMP synthase Actinobacillus pleuropneumoniae serotype 5b (strain L20)
Q87AQ5 7.55e-56 177 48 1 176 3 tsaC Threonylcarbamoyl-AMP synthase Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2I8S9 7.55e-56 177 48 1 176 3 tsaC Threonylcarbamoyl-AMP synthase Xylella fastidiosa (strain M23)
D4G8K6 2.48e-55 176 45 1 178 3 tsaC Threonylcarbamoyl-AMP synthase Riesia pediculicola (strain USDA)
Q9PEV9 5.14e-55 175 47 1 176 3 tsaC Threonylcarbamoyl-AMP synthase Xylella fastidiosa (strain 9a5c)
Q12TA0 1.42e-54 174 50 1 170 3 tsaC Threonylcarbamoyl-AMP synthase Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
B0U4N0 1.73e-54 174 47 1 176 3 tsaC Threonylcarbamoyl-AMP synthase Xylella fastidiosa (strain M12)
Q1QTJ8 2.3e-54 174 47 1 176 3 tsaC Threonylcarbamoyl-AMP synthase Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
B2FIS1 5.55e-54 172 48 1 179 3 tsaC Threonylcarbamoyl-AMP synthase Stenotrophomonas maltophilia (strain K279a)
Q48QH8 6.91e-54 172 49 3 177 3 tsaC Threonylcarbamoyl-AMP synthase Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q48AU1 7.48e-54 172 47 1 177 3 tsaC Threonylcarbamoyl-AMP synthase Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
A1SR31 8.89e-54 172 45 1 181 3 tsaC Threonylcarbamoyl-AMP synthase Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
Q83AA2 1.22e-53 172 45 4 191 3 tsaC Threonylcarbamoyl-AMP synthase Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9KH21 1.24e-53 172 45 4 191 3 tsaC Threonylcarbamoyl-AMP synthase Coxiella burnetii (strain Dugway 5J108-111)
Q1I2G9 3.01e-53 171 51 3 170 3 tsaC Threonylcarbamoyl-AMP synthase Pseudomonas entomophila (strain L48)
Q88B46 4.13e-53 170 49 3 175 3 tsaC Threonylcarbamoyl-AMP synthase Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
A4XNB6 5.6e-53 170 52 3 168 3 tsaC Threonylcarbamoyl-AMP synthase Pseudomonas mendocina (strain ymp)
A9N9G8 6.52e-53 170 44 4 191 3 tsaC Threonylcarbamoyl-AMP synthase Coxiella burnetii (strain RSA 331 / Henzerling II)
Q500S6 1.48e-52 169 48 3 175 3 tsaC Threonylcarbamoyl-AMP synthase Pseudomonas syringae pv. syringae (strain B728a)
Q3J7C4 1.7e-52 169 47 2 173 3 tsaC Threonylcarbamoyl-AMP synthase Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
Q5QXJ5 2.02e-52 169 48 1 168 3 tsaC Threonylcarbamoyl-AMP synthase Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q89A89 4.63e-52 168 45 0 177 3 tsaC Threonylcarbamoyl-AMP synthase Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q88RQ9 7.18e-52 167 47 3 175 3 tsaC Threonylcarbamoyl-AMP synthase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
B0KF32 2.62e-51 166 48 3 175 3 tsaC Threonylcarbamoyl-AMP synthase Pseudomonas putida (strain GB-1)
Q9I7A5 2.93e-51 166 49 3 173 3 tsaC Threonylcarbamoyl-AMP synthase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02V59 2.93e-51 166 49 3 173 3 tsaC Threonylcarbamoyl-AMP synthase Pseudomonas aeruginosa (strain UCBPP-PA14)
Q3KKE2 4.33e-51 165 49 3 168 3 tsaC Threonylcarbamoyl-AMP synthase Pseudomonas fluorescens (strain Pf0-1)
Q4KKQ6 4.47e-51 165 47 3 173 3 tsaC Threonylcarbamoyl-AMP synthase Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
A5VWK1 4.67e-51 165 46 3 175 3 tsaC Threonylcarbamoyl-AMP synthase Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
A1WZH9 6.47e-51 165 50 2 174 3 tsaC Threonylcarbamoyl-AMP synthase Halorhodospira halophila (strain DSM 244 / SL1)
A6UX84 1.52e-50 164 47 3 173 3 tsaC Threonylcarbamoyl-AMP synthase Pseudomonas aeruginosa (strain PA7)
B1J499 4.17e-50 163 46 3 175 3 tsaC Threonylcarbamoyl-AMP synthase Pseudomonas putida (strain W619)
Q3SG43 4.28e-50 163 45 1 172 3 tsaC Threonylcarbamoyl-AMP synthase Thiobacillus denitrificans (strain ATCC 25259)
Q1H4G9 1.56e-49 161 45 1 172 3 tsaC Threonylcarbamoyl-AMP synthase Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
Q0A5B4 2.51e-49 161 48 2 176 3 tsaC Threonylcarbamoyl-AMP synthase Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q21PU1 2.77e-49 161 46 3 189 3 tsaC Threonylcarbamoyl-AMP synthase Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
A1TWN4 7.33e-48 157 48 3 169 3 tsaC Threonylcarbamoyl-AMP synthase Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q603G8 1.02e-47 157 47 2 174 3 tsaC Threonylcarbamoyl-AMP synthase Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q0VTD8 2.42e-44 148 41 2 175 3 tsaC Threonylcarbamoyl-AMP synthase Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
B0VCB7 2.42e-44 148 42 2 180 3 tsaC Threonylcarbamoyl-AMP synthase Acinetobacter baumannii (strain AYE)
A3M154 2.42e-44 148 42 2 180 3 tsaC Threonylcarbamoyl-AMP synthase Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
B0VNL3 2.42e-44 148 42 2 180 3 tsaC Threonylcarbamoyl-AMP synthase Acinetobacter baumannii (strain SDF)
B2I111 2.42e-44 148 42 2 180 3 tsaC Threonylcarbamoyl-AMP synthase Acinetobacter baumannii (strain ACICU)
Q2SQW8 7.45e-44 147 41 2 177 3 tsaC Threonylcarbamoyl-AMP synthase Hahella chejuensis (strain KCTC 2396)
Q6FFH9 1.97e-43 146 43 3 181 3 tsaC Threonylcarbamoyl-AMP synthase Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q31JQ7 1.53e-42 144 45 3 170 3 tsaC Threonylcarbamoyl-AMP synthase Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
A6VT87 4.41e-42 142 42 2 177 3 tsaC Threonylcarbamoyl-AMP synthase Marinomonas sp. (strain MWYL1)
Q1Q7W4 2.37e-39 136 39 7 209 3 tsaC Threonylcarbamoyl-AMP synthase Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q4FPS7 5.38e-38 133 37 7 209 3 tsaC Threonylcarbamoyl-AMP synthase Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
Q7P0L7 1.45e-35 126 37 1 172 3 tsaC Threonylcarbamoyl-AMP synthase Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
A1KWL6 3.01e-34 122 39 2 173 3 tsaC Threonylcarbamoyl-AMP synthase Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
Q9JXA4 3.01e-34 122 39 2 173 3 tsaC Threonylcarbamoyl-AMP synthase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
A1IP83 3.01e-34 122 39 2 173 3 tsaC Threonylcarbamoyl-AMP synthase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
A9M4K6 3.01e-34 122 39 2 173 3 tsaC Threonylcarbamoyl-AMP synthase Neisseria meningitidis serogroup C (strain 053442)
Q5F5I5 1.56e-31 115 40 3 174 3 tsaC Threonylcarbamoyl-AMP synthase Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
D5V9A9 4.85e-31 115 36 3 185 3 tsaC Threonylcarbamoyl-AMP synthase Moraxella catarrhalis (strain BBH18)
A5EW39 1.06e-28 108 37 4 169 3 tsaC Threonylcarbamoyl-AMP synthase Dichelobacter nodosus (strain VCS1703A)
C1D9T5 4.25e-26 101 33 2 167 3 tsaC Threonylcarbamoyl-AMP synthase Laribacter hongkongensis (strain HLHK9)
Q9UYB2 2.48e-20 89 32 2 152 1 sua5 Threonylcarbamoyl-AMP synthase Pyrococcus abyssi (strain GE5 / Orsay)
P39153 2.4e-18 84 32 5 172 1 ywlC Threonylcarbamoyl-AMP synthase Bacillus subtilis (strain 168)
Q970S6 6.45e-16 77 28 1 151 1 sua5 Threonylcarbamoyl-AMP synthase Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7)
P9WGC9 2.24e-13 68 26 4 152 1 Rv1301 Putative threonylcarbamoyl-AMP synthase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGC8 2.24e-13 68 26 4 152 3 MT1340 Putative threonylcarbamoyl-AMP synthase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P32579 2.55e-11 64 25 3 162 1 SUA5 Threonylcarbamoyl-AMP synthase Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q499R4 6.48e-11 63 27 1 166 2 Yrdc Threonylcarbamoyl-AMP synthase Rattus norvegicus
P0AFR6 2.52e-10 60 25 6 175 3 yciO Uncharacterized protein YciO Shigella flexneri
P0AFR4 2.52e-10 60 25 6 175 1 yciO Uncharacterized protein YciO Escherichia coli (strain K12)
P0AFR5 2.52e-10 60 25 6 175 3 yciO Uncharacterized protein YciO Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q60369 3.26e-10 60 23 3 147 3 MJ0062 Putative threonylcarbamoyl-AMP synthase Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
P45831 5.27e-09 57 24 4 152 3 ML1136 Putative threonylcarbamoyl-AMP synthase Mycobacterium leprae (strain TN)
O94530 1.19e-08 57 25 3 164 3 sua5 Threonylcarbamoyl-AMP synthase Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q3U5F4 2.22e-07 53 28 3 167 1 Yrdc Threonylcarbamoyl-AMP synthase Mus musculus
P45103 2.99e-07 52 24 4 174 3 HI_1198 Uncharacterized protein HI_1198 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q86U90 2.4e-06 50 26 3 167 1 YRDC Threonylcarbamoyl-AMP synthase Homo sapiens
Q0VC80 3.51e-06 49 27 2 170 2 YRDC Threonylcarbamoyl-AMP synthase Bos taurus

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS16325
Feature type CDS
Gene tsaC
Product L-threonylcarbamoyladenylate synthase type 1 TsaC
Location 3603730 - 3604299 (strand: 1)
Length 570 (nucleotides) / 189 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_2397
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01300 Telomere recombination

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0009 Translation, ribosomal structure and biogenesis (J) J tRNA A37 threonylcarbamoyladenosine synthetase subunit TsaC/SUA5/YrdC

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K07566 L-threonylcarbamoyladenylate synthase [EC:2.7.7.87] - -

Protein Sequence

MNNEVSPVNNTIIEALQNNQVIAYPTEAVFGVGCDPDSESAVMALLELKQRAIEKGLILIADNYEQLKPYIDDNALTQEQRERMFASWPGPITWVIPAKSTTPKWLTGRFSSLAVRVTDHPIVKALCVAYGKPLVSTSANLSGLPPCRSVEEVQEQFRNRIAIVNGEVGGRKNPSEIRDALTGELYRQG

Flanking regions ( +/- flanking 50bp)

AGTGTGCGCCAGCAAATTGTGTGGCAAGCAACAAACAAAAAGAGAAGAACATGAATAACGAAGTATCACCTGTAAATAATACAATTATAGAAGCACTGCAAAATAATCAAGTTATTGCCTATCCAACAGAAGCTGTGTTTGGTGTCGGTTGTGATCCTGATAGTGAAAGCGCGGTAATGGCATTACTTGAGTTAAAACAGAGAGCCATTGAGAAAGGGCTTATTTTAATTGCTGATAACTATGAACAATTAAAACCTTATATTGATGATAACGCATTGACTCAAGAACAGCGGGAGCGGATGTTTGCCTCTTGGCCAGGCCCAATCACTTGGGTTATTCCAGCTAAGTCAACAACGCCAAAATGGCTAACAGGGCGGTTTTCTTCCTTAGCTGTAAGGGTTACGGATCACCCTATTGTGAAAGCATTATGTGTGGCTTATGGCAAACCATTAGTATCAACCAGCGCAAATTTAAGCGGACTTCCTCCATGCCGTAGTGTTGAAGAAGTACAAGAGCAGTTTCGTAATCGAATTGCTATTGTAAATGGCGAGGTTGGTGGCAGAAAAAATCCTTCTGAAATTAGAGATGCACTCACAGGTGAGCTATATCGACAAGGATAATGATGCTATGGAAAAATATGTAGTGATGGGCAATCCCATTGAACATAGTC