Homologs in group_2363

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_19065 FBDBKF_19065 100.0 Morganella morganii S1 tsaC L-threonylcarbamoyladenylate synthase type 1 TsaC
NLDBIP_18825 NLDBIP_18825 100.0 Morganella morganii S4 tsaC L-threonylcarbamoyladenylate synthase type 1 TsaC
LHKJJB_18680 LHKJJB_18680 100.0 Morganella morganii S3 tsaC L-threonylcarbamoyladenylate synthase type 1 TsaC
HKOGLL_18415 HKOGLL_18415 100.0 Morganella morganii S5 tsaC L-threonylcarbamoyladenylate synthase type 1 TsaC
F4V73_RS19100 F4V73_RS19100 88.9 Morganella psychrotolerans tsaC L-threonylcarbamoyladenylate synthase type 1 TsaC
PMI_RS16325 PMI_RS16325 77.8 Proteus mirabilis HI4320 tsaC L-threonylcarbamoyladenylate synthase type 1 TsaC

Distribution of the homologs in the orthogroup group_2363

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2363

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
A1JRY6 9.05e-101 291 70 0 190 3 tsaC Threonylcarbamoyl-AMP synthase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q7MYI5 5.22e-100 289 70 0 187 3 tsaC Threonylcarbamoyl-AMP synthase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A7MPF3 3.12e-99 287 71 0 190 3 tsaC Threonylcarbamoyl-AMP synthase Cronobacter sakazakii (strain ATCC BAA-894)
A6TET6 3.97e-99 287 70 0 190 3 tsaC Threonylcarbamoyl-AMP synthase Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Q31VZ4 5.51e-98 284 72 0 190 3 tsaC Threonylcarbamoyl-AMP synthase Shigella boydii serotype 4 (strain Sb227)
Q3YWX6 5.63e-98 284 72 0 190 3 tsaC Threonylcarbamoyl-AMP synthase Shigella sonnei (strain Ss046)
B2U2Q0 5.63e-98 284 72 0 190 3 tsaC Threonylcarbamoyl-AMP synthase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q1R650 5.63e-98 284 72 0 190 3 tsaC Threonylcarbamoyl-AMP synthase Escherichia coli (strain UTI89 / UPEC)
B1LGN9 5.63e-98 284 72 0 190 3 tsaC Threonylcarbamoyl-AMP synthase Escherichia coli (strain SMS-3-5 / SECEC)
Q0TCH9 5.63e-98 284 72 0 190 3 tsaC Threonylcarbamoyl-AMP synthase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AGH4 5.63e-98 284 72 0 190 3 tsaC Threonylcarbamoyl-AMP synthase Escherichia coli O1:K1 / APEC
A7ZSH1 5.63e-98 284 72 0 190 3 tsaC Threonylcarbamoyl-AMP synthase Escherichia coli O139:H28 (strain E24377A / ETEC)
P45748 6.49e-98 284 72 0 190 1 tsaC Threonylcarbamoyl-AMP synthase Escherichia coli (strain K12)
B1IQ17 6.49e-98 284 72 0 190 3 tsaC Threonylcarbamoyl-AMP synthase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A8A587 6.49e-98 284 72 0 190 3 tsaC Threonylcarbamoyl-AMP synthase Escherichia coli O9:H4 (strain HS)
B1X6D5 6.49e-98 284 72 0 190 3 tsaC Threonylcarbamoyl-AMP synthase Escherichia coli (strain K12 / DH10B)
Q8X8F8 9.32e-98 284 72 0 190 3 tsaC Threonylcarbamoyl-AMP synthase Escherichia coli O157:H7
Q0T019 1.12e-97 283 72 0 190 3 tsaC Threonylcarbamoyl-AMP synthase Shigella flexneri serotype 5b (strain 8401)
Q8FD17 2.44e-97 283 71 0 190 3 tsaC Threonylcarbamoyl-AMP synthase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A8AQH7 6.07e-97 281 71 0 190 3 tsaC Threonylcarbamoyl-AMP synthase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q32B67 6.2e-97 281 71 0 190 3 tsaC Threonylcarbamoyl-AMP synthase Shigella dysenteriae serotype 1 (strain Sd197)
Q83JD1 1.51e-96 281 71 0 190 3 tsaC Threonylcarbamoyl-AMP synthase Shigella flexneri
A8GKG1 5.97e-95 276 69 0 187 3 tsaC Threonylcarbamoyl-AMP synthase Serratia proteamaculans (strain 568)
A9MN84 2.71e-94 275 68 0 190 3 tsaC Threonylcarbamoyl-AMP synthase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
A4WF91 9.05e-94 274 67 0 190 3 tsaC Threonylcarbamoyl-AMP synthase Enterobacter sp. (strain 638)
Q8Z1W6 1.87e-93 273 68 0 190 3 tsaC Threonylcarbamoyl-AMP synthase Salmonella typhi
A9N8A7 3.6e-93 272 68 0 190 3 tsaC Threonylcarbamoyl-AMP synthase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q57J68 3.6e-93 272 68 0 190 3 tsaC Threonylcarbamoyl-AMP synthase Salmonella choleraesuis (strain SC-B67)
Q5PIS8 5.22e-93 272 68 0 190 3 tsaC Threonylcarbamoyl-AMP synthase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B1JJI2 5.28e-93 272 66 0 190 3 tsaC Threonylcarbamoyl-AMP synthase Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q664V8 5.28e-93 272 66 0 190 3 tsaC Threonylcarbamoyl-AMP synthase Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TH27 5.28e-93 272 66 0 190 3 tsaC Threonylcarbamoyl-AMP synthase Yersinia pestis (strain Pestoides F)
Q1CCY0 5.28e-93 272 66 0 190 3 tsaC Threonylcarbamoyl-AMP synthase Yersinia pestis bv. Antiqua (strain Nepal516)
A9R933 5.28e-93 272 66 0 190 3 tsaC Threonylcarbamoyl-AMP synthase Yersinia pestis bv. Antiqua (strain Angola)
Q74XX5 5.28e-93 272 66 0 190 3 tsaC Threonylcarbamoyl-AMP synthase Yersinia pestis
B2K500 5.28e-93 272 66 0 190 3 tsaC Threonylcarbamoyl-AMP synthase Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C2Y3 5.28e-93 272 66 0 190 3 tsaC Threonylcarbamoyl-AMP synthase Yersinia pestis bv. Antiqua (strain Antiqua)
A7FNJ8 5.28e-93 272 66 0 190 3 tsaC Threonylcarbamoyl-AMP synthase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q8ZLN0 1.8e-92 270 68 0 190 3 tsaC Threonylcarbamoyl-AMP synthase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
A7N129 1.06e-77 233 57 1 183 3 tsaC Threonylcarbamoyl-AMP synthase Vibrio campbellii (strain ATCC BAA-1116)
Q87KE2 5.57e-77 231 58 1 183 3 tsaC Threonylcarbamoyl-AMP synthase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q6LLJ9 1.22e-76 230 57 1 183 3 tsaC Threonylcarbamoyl-AMP synthase Photobacterium profundum (strain SS9)
Q1LT55 1.58e-76 230 58 0 178 3 tsaC Threonylcarbamoyl-AMP synthase Baumannia cicadellinicola subsp. Homalodisca coagulata
Q5E1R5 1.53e-75 227 59 1 183 3 tsaC Threonylcarbamoyl-AMP synthase Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q2NQQ7 1.56e-74 225 59 0 190 3 tsaC Threonylcarbamoyl-AMP synthase Sodalis glossinidius (strain morsitans)
A5UHE9 4.93e-71 216 56 0 182 3 tsaC Threonylcarbamoyl-AMP synthase Haemophilus influenzae (strain PittGG)
Q4QMR0 5.21e-71 216 55 0 182 3 tsaC Threonylcarbamoyl-AMP synthase Haemophilus influenzae (strain 86-028NP)
Q9KVT5 1.07e-70 215 56 1 183 3 tsaC Threonylcarbamoyl-AMP synthase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F4C5 1.07e-70 215 56 1 183 3 tsaC Threonylcarbamoyl-AMP synthase Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
P44807 1.25e-70 215 55 0 182 1 tsaC Threonylcarbamoyl-AMP synthase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UE77 5.18e-70 213 55 0 182 3 tsaC Threonylcarbamoyl-AMP synthase Haemophilus influenzae (strain PittEE)
A4ST51 8.56e-70 213 56 1 183 3 tsaC Threonylcarbamoyl-AMP synthase Aeromonas salmonicida (strain A449)
B1KCX0 9.59e-69 210 54 1 175 3 tsaC Threonylcarbamoyl-AMP synthase Shewanella woodyi (strain ATCC 51908 / MS32)
Q7MGL3 3.6e-68 209 53 1 184 3 tsaC Threonylcarbamoyl-AMP synthase Vibrio vulnificus (strain YJ016)
Q8DDD6 3.6e-68 209 53 1 184 3 tsaC Threonylcarbamoyl-AMP synthase Vibrio vulnificus (strain CMCP6)
A3QJE8 5.7e-68 208 54 1 177 3 tsaC Threonylcarbamoyl-AMP synthase Shewanella loihica (strain ATCC BAA-1088 / PV-4)
Q3IDH7 7.24e-68 208 56 1 176 3 tsaC Threonylcarbamoyl-AMP synthase Pseudoalteromonas translucida (strain TAC 125)
A0KEX6 1.08e-67 207 56 1 181 3 tsaC Threonylcarbamoyl-AMP synthase Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
A6VL69 2.02e-67 207 56 0 182 3 tsaC Threonylcarbamoyl-AMP synthase Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
Q493I0 6.21e-67 206 51 0 184 3 tsaC Threonylcarbamoyl-AMP synthase Blochmanniella pennsylvanica (strain BPEN)
P57561 1.99e-66 204 51 0 172 3 tsaC Threonylcarbamoyl-AMP synthase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q9CLG4 2.61e-66 204 54 0 182 3 tsaC Threonylcarbamoyl-AMP synthase Pasteurella multocida (strain Pm70)
Q8EKQ3 5.15e-65 201 54 1 173 3 tsaC Threonylcarbamoyl-AMP synthase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
A8FP81 7.39e-65 200 50 1 179 3 tsaC Threonylcarbamoyl-AMP synthase Shewanella sediminis (strain HAW-EB3)
Q65WC1 1.31e-64 199 52 0 178 3 tsaC Threonylcarbamoyl-AMP synthase Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q8K977 2.79e-64 199 46 0 188 3 tsaC Threonylcarbamoyl-AMP synthase Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q0I1B6 4.69e-64 198 51 0 182 3 tsaC Threonylcarbamoyl-AMP synthase Histophilus somni (strain 129Pt)
B0UWV9 4.84e-64 198 51 0 182 3 tsaC Threonylcarbamoyl-AMP synthase Histophilus somni (strain 2336)
Q15ZX7 1.33e-63 197 52 0 168 3 tsaC Threonylcarbamoyl-AMP synthase Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q7VQB9 1.44e-63 197 48 0 189 3 tsaC Threonylcarbamoyl-AMP synthase Blochmanniella floridana
Q0I0R7 2.16e-63 197 53 1 173 3 tsaC Threonylcarbamoyl-AMP synthase Shewanella sp. (strain MR-7)
Q0HPA1 2.16e-63 197 53 1 173 3 tsaC Threonylcarbamoyl-AMP synthase Shewanella sp. (strain MR-4)
A0KR66 2.54e-63 196 53 1 173 3 tsaC Threonylcarbamoyl-AMP synthase Shewanella sp. (strain ANA-3)
A9KUA7 1.54e-62 194 54 1 170 3 tsaC Threonylcarbamoyl-AMP synthase Shewanella baltica (strain OS195)
A1RDY7 1.92e-62 194 53 1 173 3 tsaC Threonylcarbamoyl-AMP synthase Shewanella sp. (strain W3-18-1)
A4Y1D2 1.92e-62 194 53 1 173 3 tsaC Threonylcarbamoyl-AMP synthase Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
A6WHB6 5.34e-62 193 54 1 170 3 tsaC Threonylcarbamoyl-AMP synthase Shewanella baltica (strain OS185)
A3CYL0 5.34e-62 193 54 1 170 3 tsaC Threonylcarbamoyl-AMP synthase Shewanella baltica (strain OS155 / ATCC BAA-1091)
B0BQ80 1.04e-61 192 50 0 182 3 tsaC Threonylcarbamoyl-AMP synthase Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B3GY27 1.04e-61 192 50 0 182 3 tsaC Threonylcarbamoyl-AMP synthase Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A1S1K5 1.34e-61 192 54 1 175 3 tsaC Threonylcarbamoyl-AMP synthase Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
A8GYH9 3.86e-61 191 55 1 170 3 tsaC Threonylcarbamoyl-AMP synthase Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
A3N1E4 9.27e-61 190 50 0 182 3 tsaC Threonylcarbamoyl-AMP synthase Actinobacillus pleuropneumoniae serotype 5b (strain L20)
B3PGZ1 3.06e-60 189 57 2 168 3 tsaC Threonylcarbamoyl-AMP synthase Cellvibrio japonicus (strain Ueda107)
B0TLD6 4.03e-60 188 54 1 170 3 tsaC Threonylcarbamoyl-AMP synthase Shewanella halifaxensis (strain HAW-EB4)
Q8P4F2 1.04e-58 185 49 1 183 3 tsaC Threonylcarbamoyl-AMP synthase Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RWR5 1.04e-58 185 49 1 183 3 tsaC Threonylcarbamoyl-AMP synthase Xanthomonas campestris pv. campestris (strain B100)
Q4UQ07 1.04e-58 185 49 1 183 3 tsaC Threonylcarbamoyl-AMP synthase Xanthomonas campestris pv. campestris (strain 8004)
D4G8K6 3.1e-58 184 47 1 178 3 tsaC Threonylcarbamoyl-AMP synthase Riesia pediculicola (strain USDA)
Q08A23 2.09e-57 181 50 1 170 3 tsaC Threonylcarbamoyl-AMP synthase Shewanella frigidimarina (strain NCIMB 400)
Q7VNS3 2.98e-57 181 46 0 182 3 tsaC Threonylcarbamoyl-AMP synthase Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q3BNJ9 1.7e-56 179 47 1 183 3 tsaC Threonylcarbamoyl-AMP synthase Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q12TA0 3.93e-56 178 50 1 170 3 tsaC Threonylcarbamoyl-AMP synthase Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q48AU1 5.09e-56 178 48 1 177 3 tsaC Threonylcarbamoyl-AMP synthase Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
A1SR31 8.4e-56 177 47 1 178 3 tsaC Threonylcarbamoyl-AMP synthase Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
Q8PG13 2.14e-55 176 47 1 183 3 tsaC Threonylcarbamoyl-AMP synthase Xanthomonas axonopodis pv. citri (strain 306)
Q5H5D8 3.03e-55 176 46 2 189 3 tsaC Threonylcarbamoyl-AMP synthase Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
B2SL46 3.03e-55 176 46 2 189 3 tsaC Threonylcarbamoyl-AMP synthase Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q2P833 3.03e-55 176 46 2 189 3 tsaC Threonylcarbamoyl-AMP synthase Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q5QXJ5 5.4e-55 175 51 1 168 3 tsaC Threonylcarbamoyl-AMP synthase Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q8D257 4.27e-54 173 42 0 187 3 tsaC Threonylcarbamoyl-AMP synthase Wigglesworthia glossinidia brevipalpis
Q89A89 5.8e-53 170 45 0 174 3 tsaC Threonylcarbamoyl-AMP synthase Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
B2FIS1 4.17e-52 168 45 1 181 3 tsaC Threonylcarbamoyl-AMP synthase Stenotrophomonas maltophilia (strain K279a)
Q87AQ5 5.87e-51 165 44 1 184 3 tsaC Threonylcarbamoyl-AMP synthase Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2I8S9 5.87e-51 165 44 1 184 3 tsaC Threonylcarbamoyl-AMP synthase Xylella fastidiosa (strain M23)
B0U4N0 6.76e-51 165 44 1 184 3 tsaC Threonylcarbamoyl-AMP synthase Xylella fastidiosa (strain M12)
Q603G8 9.5e-51 164 51 3 176 3 tsaC Threonylcarbamoyl-AMP synthase Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q1H4G9 3.51e-50 163 47 1 172 3 tsaC Threonylcarbamoyl-AMP synthase Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
Q9PEV9 6.88e-50 162 43 1 184 3 tsaC Threonylcarbamoyl-AMP synthase Xylella fastidiosa (strain 9a5c)
Q3J7C4 7.79e-50 162 46 2 175 3 tsaC Threonylcarbamoyl-AMP synthase Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
A4VFI1 4.21e-49 160 48 3 177 3 tsaC Threonylcarbamoyl-AMP synthase Stutzerimonas stutzeri (strain A1501)
A1WZH9 4.34e-49 160 50 2 174 3 tsaC Threonylcarbamoyl-AMP synthase Halorhodospira halophila (strain DSM 244 / SL1)
Q1QTJ8 9.73e-49 159 44 1 186 3 tsaC Threonylcarbamoyl-AMP synthase Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q88B46 1.49e-48 159 50 3 170 3 tsaC Threonylcarbamoyl-AMP synthase Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q88RQ9 1.81e-48 159 50 3 170 3 tsaC Threonylcarbamoyl-AMP synthase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q48QH8 2e-48 159 50 3 170 3 tsaC Threonylcarbamoyl-AMP synthase Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
A1TWN4 2.53e-48 158 49 3 169 3 tsaC Threonylcarbamoyl-AMP synthase Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q9I7A5 3.44e-48 158 50 3 168 3 tsaC Threonylcarbamoyl-AMP synthase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02V59 3.44e-48 158 50 3 168 3 tsaC Threonylcarbamoyl-AMP synthase Pseudomonas aeruginosa (strain UCBPP-PA14)
B0KF32 5.09e-48 157 50 3 170 3 tsaC Threonylcarbamoyl-AMP synthase Pseudomonas putida (strain GB-1)
Q500S6 6.26e-48 157 50 3 170 3 tsaC Threonylcarbamoyl-AMP synthase Pseudomonas syringae pv. syringae (strain B728a)
A5VWK1 9.56e-48 157 49 3 170 3 tsaC Threonylcarbamoyl-AMP synthase Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
A4XNB6 9.77e-48 157 51 3 168 3 tsaC Threonylcarbamoyl-AMP synthase Pseudomonas mendocina (strain ymp)
A6UX84 1.38e-47 156 51 3 168 3 tsaC Threonylcarbamoyl-AMP synthase Pseudomonas aeruginosa (strain PA7)
Q3SG43 1.73e-47 156 45 1 172 3 tsaC Threonylcarbamoyl-AMP synthase Thiobacillus denitrificans (strain ATCC 25259)
Q21PU1 2.45e-47 156 43 2 189 3 tsaC Threonylcarbamoyl-AMP synthase Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q4KKQ6 6.35e-47 155 49 3 168 3 tsaC Threonylcarbamoyl-AMP synthase Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q2SQW8 1.21e-46 154 45 2 177 3 tsaC Threonylcarbamoyl-AMP synthase Hahella chejuensis (strain KCTC 2396)
Q1I2G9 2.47e-46 153 48 3 170 3 tsaC Threonylcarbamoyl-AMP synthase Pseudomonas entomophila (strain L48)
Q0A5B4 2.52e-46 153 46 2 176 3 tsaC Threonylcarbamoyl-AMP synthase Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q83AA2 3.31e-46 153 41 2 183 3 tsaC Threonylcarbamoyl-AMP synthase Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9KH21 3.85e-46 153 41 2 183 3 tsaC Threonylcarbamoyl-AMP synthase Coxiella burnetii (strain Dugway 5J108-111)
A9N9G8 8.8e-46 152 41 2 183 3 tsaC Threonylcarbamoyl-AMP synthase Coxiella burnetii (strain RSA 331 / Henzerling II)
B1J499 9.52e-46 152 47 3 170 3 tsaC Threonylcarbamoyl-AMP synthase Pseudomonas putida (strain W619)
Q3KKE2 3.11e-45 150 48 3 168 3 tsaC Threonylcarbamoyl-AMP synthase Pseudomonas fluorescens (strain Pf0-1)
Q6FFH9 8.36e-42 142 42 3 181 3 tsaC Threonylcarbamoyl-AMP synthase Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q0VTD8 1.61e-41 141 41 2 168 3 tsaC Threonylcarbamoyl-AMP synthase Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q31JQ7 2.06e-41 140 44 4 178 3 tsaC Threonylcarbamoyl-AMP synthase Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
B0VCB7 1.84e-40 138 41 2 180 3 tsaC Threonylcarbamoyl-AMP synthase Acinetobacter baumannii (strain AYE)
A3M154 1.84e-40 138 41 2 180 3 tsaC Threonylcarbamoyl-AMP synthase Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
B0VNL3 1.84e-40 138 41 2 180 3 tsaC Threonylcarbamoyl-AMP synthase Acinetobacter baumannii (strain SDF)
B2I111 1.84e-40 138 41 2 180 3 tsaC Threonylcarbamoyl-AMP synthase Acinetobacter baumannii (strain ACICU)
A6VT87 2.79e-40 138 42 2 168 3 tsaC Threonylcarbamoyl-AMP synthase Marinomonas sp. (strain MWYL1)
Q7P0L7 3.63e-37 130 38 1 174 3 tsaC Threonylcarbamoyl-AMP synthase Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q1Q7W4 7.44e-37 130 41 8 208 3 tsaC Threonylcarbamoyl-AMP synthase Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
A1KWL6 2.71e-35 125 38 2 173 3 tsaC Threonylcarbamoyl-AMP synthase Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
Q9JXA4 2.71e-35 125 38 2 173 3 tsaC Threonylcarbamoyl-AMP synthase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
A1IP83 2.71e-35 125 38 2 173 3 tsaC Threonylcarbamoyl-AMP synthase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
A9M4K6 2.71e-35 125 38 2 173 3 tsaC Threonylcarbamoyl-AMP synthase Neisseria meningitidis serogroup C (strain 053442)
Q4FPS7 5.82e-34 122 37 7 208 3 tsaC Threonylcarbamoyl-AMP synthase Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
Q5F5I5 4.94e-33 119 40 3 174 3 tsaC Threonylcarbamoyl-AMP synthase Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
A5EW39 8.76e-29 108 35 3 180 3 tsaC Threonylcarbamoyl-AMP synthase Dichelobacter nodosus (strain VCS1703A)
D5V9A9 1.45e-27 105 33 4 192 3 tsaC Threonylcarbamoyl-AMP synthase Moraxella catarrhalis (strain BBH18)
C1D9T5 3.25e-26 102 34 2 167 3 tsaC Threonylcarbamoyl-AMP synthase Laribacter hongkongensis (strain HLHK9)
Q9UYB2 4.89e-19 86 30 2 152 1 sua5 Threonylcarbamoyl-AMP synthase Pyrococcus abyssi (strain GE5 / Orsay)
P39153 6.21e-19 85 33 3 153 1 ywlC Threonylcarbamoyl-AMP synthase Bacillus subtilis (strain 168)
Q970S6 5.2e-18 83 31 2 153 1 sua5 Threonylcarbamoyl-AMP synthase Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7)
Q60369 9.73e-14 69 23 3 165 3 MJ0062 Putative threonylcarbamoyl-AMP synthase Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
P32579 1.84e-12 68 29 4 162 1 SUA5 Threonylcarbamoyl-AMP synthase Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
O94530 1.55e-11 65 27 4 167 3 sua5 Threonylcarbamoyl-AMP synthase Schizosaccharomyces pombe (strain 972 / ATCC 24843)
P9WGC9 1.51e-10 61 24 2 161 1 Rv1301 Putative threonylcarbamoyl-AMP synthase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGC8 1.51e-10 61 24 2 161 3 MT1340 Putative threonylcarbamoyl-AMP synthase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0AFR6 1.36e-09 58 26 2 126 3 yciO Uncharacterized protein YciO Shigella flexneri
P0AFR4 1.36e-09 58 26 2 126 1 yciO Uncharacterized protein YciO Escherichia coli (strain K12)
P0AFR5 1.36e-09 58 26 2 126 3 yciO Uncharacterized protein YciO Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q499R4 5.76e-09 57 28 2 161 2 Yrdc Threonylcarbamoyl-AMP synthase Rattus norvegicus
P45831 2.08e-08 55 24 3 157 3 ML1136 Putative threonylcarbamoyl-AMP synthase Mycobacterium leprae (strain TN)
P45103 2.65e-08 55 22 3 174 3 HI_1198 Uncharacterized protein HI_1198 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q0VC80 1.03e-05 48 26 2 136 2 YRDC Threonylcarbamoyl-AMP synthase Bos taurus
Q3U5F4 4.54e-05 46 29 2 161 1 Yrdc Threonylcarbamoyl-AMP synthase Mus musculus
Q86U90 0.000124 45 29 2 141 1 YRDC Threonylcarbamoyl-AMP synthase Homo sapiens

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_18810
Feature type CDS
Gene tsaC
Product L-threonylcarbamoyladenylate synthase type 1 TsaC
Location 2015 - 2587 (strand: -1)
Length 573 (nucleotides) / 190 (amino acids)

Contig

Accession ZDB_240
Length 24827 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2363
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01300 Telomere recombination

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0009 Translation, ribosomal structure and biogenesis (J) J tRNA A37 threonylcarbamoyladenosine synthetase subunit TsaC/SUA5/YrdC

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K07566 L-threonylcarbamoyladenylate synthase [EC:2.7.7.87] - -

Protein Sequence

MNHNQTTANFDTIIKALNNHEVIAYPTEAVFGLGCDPDSEQAVMALLDLKQRPWEKGLILIADNYDQVKPYIDDSRLTDEQREAMFASWPGPVTWVIPAKPATPKWLTGRFDSLAVRVTDHPVVKALCQAYGKPVVSTSANLSGLEPCRTTDEVNAQFNGRIPVVDGLVGGRKNPSEIRDALTGQLYRQG

Flanking regions ( +/- flanking 50bp)

TGCGAGTAAAGCCTGCGCAAAACGACAAAAAGAACAAAATGAGAATAATGATGAATCATAATCAAACCACAGCAAATTTCGACACAATTATAAAAGCCCTGAATAACCACGAAGTTATCGCATATCCGACAGAGGCTGTTTTTGGCCTGGGTTGTGATCCTGACAGTGAGCAGGCCGTGATGGCGCTGCTGGATCTGAAACAGCGCCCGTGGGAAAAAGGACTGATTCTGATCGCAGATAACTATGATCAGGTAAAACCTTATATTGATGACTCACGGCTGACAGATGAGCAGCGTGAAGCGATGTTTGCCTCCTGGCCGGGCCCGGTGACCTGGGTGATCCCGGCAAAACCCGCCACACCAAAATGGCTGACCGGCCGTTTTGACTCGCTGGCTGTCCGCGTGACAGATCATCCGGTGGTCAAAGCATTATGTCAGGCGTACGGCAAACCGGTGGTCTCCACCAGTGCGAACCTGAGCGGGCTGGAGCCATGCCGGACAACTGATGAAGTAAATGCACAGTTTAACGGACGGATCCCGGTGGTTGACGGGCTGGTCGGTGGGCGGAAAAATCCGTCTGAGATCCGTGATGCACTGACAGGGCAGTTATACCGCCAGGGCTGACAGAACACCAAAAGGACCCGGAATGAAAAAATTTGCCGTTTTTGGCCATC