Homologs in group_2397

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_19065 FBDBKF_19065 88.9 Morganella morganii S1 tsaC L-threonylcarbamoyladenylate synthase type 1 TsaC
EHELCC_18810 EHELCC_18810 88.9 Morganella morganii S2 tsaC L-threonylcarbamoyladenylate synthase type 1 TsaC
NLDBIP_18825 NLDBIP_18825 88.9 Morganella morganii S4 tsaC L-threonylcarbamoyladenylate synthase type 1 TsaC
LHKJJB_18680 LHKJJB_18680 88.9 Morganella morganii S3 tsaC L-threonylcarbamoyladenylate synthase type 1 TsaC
HKOGLL_18415 HKOGLL_18415 88.9 Morganella morganii S5 tsaC L-threonylcarbamoyladenylate synthase type 1 TsaC
PMI_RS16325 PMI_RS16325 75.1 Proteus mirabilis HI4320 tsaC L-threonylcarbamoyladenylate synthase type 1 TsaC

Distribution of the homologs in the orthogroup group_2397

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2397

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q7MYI5 5.89e-100 289 70 0 187 3 tsaC Threonylcarbamoyl-AMP synthase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A6TET6 2.76e-97 283 69 0 190 3 tsaC Threonylcarbamoyl-AMP synthase Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
A7MPF3 4.09e-97 282 70 0 190 3 tsaC Threonylcarbamoyl-AMP synthase Cronobacter sakazakii (strain ATCC BAA-894)
A1JRY6 6e-97 281 68 0 190 3 tsaC Threonylcarbamoyl-AMP synthase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q3YWX6 2.41e-96 280 70 0 190 3 tsaC Threonylcarbamoyl-AMP synthase Shigella sonnei (strain Ss046)
B2U2Q0 2.41e-96 280 70 0 190 3 tsaC Threonylcarbamoyl-AMP synthase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q1R650 2.41e-96 280 70 0 190 3 tsaC Threonylcarbamoyl-AMP synthase Escherichia coli (strain UTI89 / UPEC)
B1LGN9 2.41e-96 280 70 0 190 3 tsaC Threonylcarbamoyl-AMP synthase Escherichia coli (strain SMS-3-5 / SECEC)
Q0TCH9 2.41e-96 280 70 0 190 3 tsaC Threonylcarbamoyl-AMP synthase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AGH4 2.41e-96 280 70 0 190 3 tsaC Threonylcarbamoyl-AMP synthase Escherichia coli O1:K1 / APEC
A7ZSH1 2.41e-96 280 70 0 190 3 tsaC Threonylcarbamoyl-AMP synthase Escherichia coli O139:H28 (strain E24377A / ETEC)
Q31VZ4 3.54e-96 280 70 0 190 3 tsaC Threonylcarbamoyl-AMP synthase Shigella boydii serotype 4 (strain Sb227)
Q8X8F8 4.08e-96 280 70 0 190 3 tsaC Threonylcarbamoyl-AMP synthase Escherichia coli O157:H7
P45748 6.99e-96 279 70 0 190 1 tsaC Threonylcarbamoyl-AMP synthase Escherichia coli (strain K12)
B1IQ17 6.99e-96 279 70 0 190 3 tsaC Threonylcarbamoyl-AMP synthase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A8A587 6.99e-96 279 70 0 190 3 tsaC Threonylcarbamoyl-AMP synthase Escherichia coli O9:H4 (strain HS)
B1X6D5 6.99e-96 279 70 0 190 3 tsaC Threonylcarbamoyl-AMP synthase Escherichia coli (strain K12 / DH10B)
Q0T019 7.22e-96 279 70 0 190 3 tsaC Threonylcarbamoyl-AMP synthase Shigella flexneri serotype 5b (strain 8401)
Q8FD17 1.03e-95 278 70 0 190 3 tsaC Threonylcarbamoyl-AMP synthase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q32B67 2.69e-95 278 70 0 190 3 tsaC Threonylcarbamoyl-AMP synthase Shigella dysenteriae serotype 1 (strain Sd197)
Q83JD1 1e-94 276 70 0 190 3 tsaC Threonylcarbamoyl-AMP synthase Shigella flexneri
A9MN84 1.91e-94 275 68 0 190 3 tsaC Threonylcarbamoyl-AMP synthase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
A8AQH7 1.24e-93 273 68 0 190 3 tsaC Threonylcarbamoyl-AMP synthase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q8Z1W6 3.64e-93 272 68 0 190 3 tsaC Threonylcarbamoyl-AMP synthase Salmonella typhi
A9N8A7 6.5e-93 271 68 0 190 3 tsaC Threonylcarbamoyl-AMP synthase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q57J68 6.5e-93 271 68 0 190 3 tsaC Threonylcarbamoyl-AMP synthase Salmonella choleraesuis (strain SC-B67)
Q8ZLN0 8.37e-93 271 68 0 190 3 tsaC Threonylcarbamoyl-AMP synthase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q5PIS8 1.23e-92 271 67 0 190 3 tsaC Threonylcarbamoyl-AMP synthase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
A8GKG1 1.45e-92 271 67 0 187 3 tsaC Threonylcarbamoyl-AMP synthase Serratia proteamaculans (strain 568)
B1JJI2 5.57e-92 269 65 0 190 3 tsaC Threonylcarbamoyl-AMP synthase Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q664V8 5.57e-92 269 65 0 190 3 tsaC Threonylcarbamoyl-AMP synthase Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TH27 5.57e-92 269 65 0 190 3 tsaC Threonylcarbamoyl-AMP synthase Yersinia pestis (strain Pestoides F)
Q1CCY0 5.57e-92 269 65 0 190 3 tsaC Threonylcarbamoyl-AMP synthase Yersinia pestis bv. Antiqua (strain Nepal516)
A9R933 5.57e-92 269 65 0 190 3 tsaC Threonylcarbamoyl-AMP synthase Yersinia pestis bv. Antiqua (strain Angola)
Q74XX5 5.57e-92 269 65 0 190 3 tsaC Threonylcarbamoyl-AMP synthase Yersinia pestis
B2K500 5.57e-92 269 65 0 190 3 tsaC Threonylcarbamoyl-AMP synthase Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C2Y3 5.57e-92 269 65 0 190 3 tsaC Threonylcarbamoyl-AMP synthase Yersinia pestis bv. Antiqua (strain Antiqua)
A7FNJ8 5.57e-92 269 65 0 190 3 tsaC Threonylcarbamoyl-AMP synthase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A4WF91 1.64e-89 263 65 0 190 3 tsaC Threonylcarbamoyl-AMP synthase Enterobacter sp. (strain 638)
Q1LT55 4.87e-80 239 60 0 178 3 tsaC Threonylcarbamoyl-AMP synthase Baumannia cicadellinicola subsp. Homalodisca coagulata
A7N129 6.08e-77 231 56 1 183 3 tsaC Threonylcarbamoyl-AMP synthase Vibrio campbellii (strain ATCC BAA-1116)
Q87KE2 6.42e-77 231 57 1 183 3 tsaC Threonylcarbamoyl-AMP synthase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q6LLJ9 1.95e-73 222 54 1 183 3 tsaC Threonylcarbamoyl-AMP synthase Photobacterium profundum (strain SS9)
Q2NQQ7 1.38e-72 220 57 0 190 3 tsaC Threonylcarbamoyl-AMP synthase Sodalis glossinidius (strain morsitans)
Q5E1R5 1.43e-72 220 55 1 183 3 tsaC Threonylcarbamoyl-AMP synthase Aliivibrio fischeri (strain ATCC 700601 / ES114)
A4ST51 2.84e-70 214 55 1 183 3 tsaC Threonylcarbamoyl-AMP synthase Aeromonas salmonicida (strain A449)
Q9KVT5 5.01e-70 213 54 1 183 3 tsaC Threonylcarbamoyl-AMP synthase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F4C5 5.01e-70 213 54 1 183 3 tsaC Threonylcarbamoyl-AMP synthase Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q7MGL3 1.88e-69 212 54 1 184 3 tsaC Threonylcarbamoyl-AMP synthase Vibrio vulnificus (strain YJ016)
Q8DDD6 1.88e-69 212 54 1 184 3 tsaC Threonylcarbamoyl-AMP synthase Vibrio vulnificus (strain CMCP6)
A5UHE9 3.21e-69 211 54 0 182 3 tsaC Threonylcarbamoyl-AMP synthase Haemophilus influenzae (strain PittGG)
P44807 8.05e-69 210 54 0 182 1 tsaC Threonylcarbamoyl-AMP synthase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A0KEX6 8.32e-69 210 56 1 182 3 tsaC Threonylcarbamoyl-AMP synthase Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
A6VL69 2.13e-68 209 57 0 182 3 tsaC Threonylcarbamoyl-AMP synthase Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
Q4QMR0 2.35e-68 209 54 0 182 3 tsaC Threonylcarbamoyl-AMP synthase Haemophilus influenzae (strain 86-028NP)
A5UE77 3.26e-68 209 54 0 182 3 tsaC Threonylcarbamoyl-AMP synthase Haemophilus influenzae (strain PittEE)
Q493I0 2.62e-67 207 52 0 184 3 tsaC Threonylcarbamoyl-AMP synthase Blochmanniella pennsylvanica (strain BPEN)
Q7VQB9 2.84e-66 204 52 1 184 3 tsaC Threonylcarbamoyl-AMP synthase Blochmanniella floridana
Q3IDH7 3.46e-66 204 52 1 182 3 tsaC Threonylcarbamoyl-AMP synthase Pseudoalteromonas translucida (strain TAC 125)
Q9CLG4 1.04e-64 200 54 0 182 3 tsaC Threonylcarbamoyl-AMP synthase Pasteurella multocida (strain Pm70)
B1KCX0 1.14e-64 200 52 1 175 3 tsaC Threonylcarbamoyl-AMP synthase Shewanella woodyi (strain ATCC 51908 / MS32)
Q8K977 1.3e-64 200 50 0 181 3 tsaC Threonylcarbamoyl-AMP synthase Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
A3QJE8 1.91e-64 199 55 1 168 3 tsaC Threonylcarbamoyl-AMP synthase Shewanella loihica (strain ATCC BAA-1088 / PV-4)
P57561 2.04e-63 196 49 0 173 3 tsaC Threonylcarbamoyl-AMP synthase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
A1S1K5 1.16e-62 195 54 2 186 3 tsaC Threonylcarbamoyl-AMP synthase Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
Q15ZX7 1.4e-62 194 51 0 168 3 tsaC Threonylcarbamoyl-AMP synthase Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
A1RDY7 1.51e-62 194 51 1 179 3 tsaC Threonylcarbamoyl-AMP synthase Shewanella sp. (strain W3-18-1)
A4Y1D2 1.51e-62 194 51 1 179 3 tsaC Threonylcarbamoyl-AMP synthase Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
A9KUA7 1.94e-62 194 51 1 179 3 tsaC Threonylcarbamoyl-AMP synthase Shewanella baltica (strain OS195)
A6WHB6 5.9e-62 193 51 1 179 3 tsaC Threonylcarbamoyl-AMP synthase Shewanella baltica (strain OS185)
A3CYL0 5.9e-62 193 51 1 179 3 tsaC Threonylcarbamoyl-AMP synthase Shewanella baltica (strain OS155 / ATCC BAA-1091)
Q65WC1 2.03e-61 191 51 0 178 3 tsaC Threonylcarbamoyl-AMP synthase Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
A8FP81 2.08e-61 191 48 1 179 3 tsaC Threonylcarbamoyl-AMP synthase Shewanella sediminis (strain HAW-EB3)
A8GYH9 2.94e-61 191 55 1 170 3 tsaC Threonylcarbamoyl-AMP synthase Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
Q0I1B6 7.46e-61 190 50 0 182 3 tsaC Threonylcarbamoyl-AMP synthase Histophilus somni (strain 129Pt)
Q8EKQ3 8.1e-61 190 51 1 179 3 tsaC Threonylcarbamoyl-AMP synthase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
B0UWV9 8.32e-61 190 50 0 182 3 tsaC Threonylcarbamoyl-AMP synthase Histophilus somni (strain 2336)
B0TLD6 8.47e-61 190 51 1 179 3 tsaC Threonylcarbamoyl-AMP synthase Shewanella halifaxensis (strain HAW-EB4)
Q8P4F2 9.76e-61 190 50 1 181 3 tsaC Threonylcarbamoyl-AMP synthase Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RWR5 9.76e-61 190 50 1 181 3 tsaC Threonylcarbamoyl-AMP synthase Xanthomonas campestris pv. campestris (strain B100)
Q4UQ07 9.76e-61 190 50 1 181 3 tsaC Threonylcarbamoyl-AMP synthase Xanthomonas campestris pv. campestris (strain 8004)
B3PGZ1 1.61e-60 189 55 2 175 3 tsaC Threonylcarbamoyl-AMP synthase Cellvibrio japonicus (strain Ueda107)
Q0I0R7 1.94e-60 189 50 1 179 3 tsaC Threonylcarbamoyl-AMP synthase Shewanella sp. (strain MR-7)
Q0HPA1 1.94e-60 189 50 1 179 3 tsaC Threonylcarbamoyl-AMP synthase Shewanella sp. (strain MR-4)
A0KR66 4.12e-60 188 50 1 179 3 tsaC Threonylcarbamoyl-AMP synthase Shewanella sp. (strain ANA-3)
B0BQ80 1.84e-59 186 48 0 183 3 tsaC Threonylcarbamoyl-AMP synthase Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B3GY27 1.84e-59 186 48 0 183 3 tsaC Threonylcarbamoyl-AMP synthase Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3N1E4 2.04e-58 184 48 0 183 3 tsaC Threonylcarbamoyl-AMP synthase Actinobacillus pleuropneumoniae serotype 5b (strain L20)
Q7VNS3 2.17e-57 181 45 0 183 3 tsaC Threonylcarbamoyl-AMP synthase Haemophilus ducreyi (strain 35000HP / ATCC 700724)
A1SR31 2.51e-57 181 46 1 184 3 tsaC Threonylcarbamoyl-AMP synthase Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
Q5H5D8 3.21e-57 181 47 1 181 3 tsaC Threonylcarbamoyl-AMP synthase Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
B2SL46 3.21e-57 181 47 1 181 3 tsaC Threonylcarbamoyl-AMP synthase Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q2P833 3.21e-57 181 47 1 181 3 tsaC Threonylcarbamoyl-AMP synthase Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q08A23 4.16e-57 181 50 1 170 3 tsaC Threonylcarbamoyl-AMP synthase Shewanella frigidimarina (strain NCIMB 400)
Q3BNJ9 4.65e-57 181 46 1 181 3 tsaC Threonylcarbamoyl-AMP synthase Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q12TA0 8.54e-57 180 49 1 176 3 tsaC Threonylcarbamoyl-AMP synthase Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q5QXJ5 4.96e-56 178 51 1 168 3 tsaC Threonylcarbamoyl-AMP synthase Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
D4G8K6 1.7e-55 176 46 1 178 3 tsaC Threonylcarbamoyl-AMP synthase Riesia pediculicola (strain USDA)
Q8PG13 3.97e-55 176 46 1 181 3 tsaC Threonylcarbamoyl-AMP synthase Xanthomonas axonopodis pv. citri (strain 306)
Q8D257 5.33e-55 176 42 0 187 3 tsaC Threonylcarbamoyl-AMP synthase Wigglesworthia glossinidia brevipalpis
Q48AU1 1.34e-53 172 46 1 177 3 tsaC Threonylcarbamoyl-AMP synthase Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q89A89 4.93e-53 170 45 0 174 3 tsaC Threonylcarbamoyl-AMP synthase Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
A4VFI1 5.73e-52 167 50 3 177 3 tsaC Threonylcarbamoyl-AMP synthase Stutzerimonas stutzeri (strain A1501)
Q3J7C4 7.04e-52 167 47 2 175 3 tsaC Threonylcarbamoyl-AMP synthase Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
Q603G8 1.44e-51 166 50 3 177 3 tsaC Threonylcarbamoyl-AMP synthase Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q88RQ9 1.54e-51 166 51 3 170 3 tsaC Threonylcarbamoyl-AMP synthase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
A1WZH9 3.57e-51 166 50 2 174 3 tsaC Threonylcarbamoyl-AMP synthase Halorhodospira halophila (strain DSM 244 / SL1)
Q48QH8 4.03e-51 165 51 3 170 3 tsaC Threonylcarbamoyl-AMP synthase Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q88B46 5.23e-51 165 51 3 170 3 tsaC Threonylcarbamoyl-AMP synthase Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q1H4G9 5.28e-51 165 46 1 174 3 tsaC Threonylcarbamoyl-AMP synthase Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
A5VWK1 8.72e-51 164 51 3 170 3 tsaC Threonylcarbamoyl-AMP synthase Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q500S6 2.08e-50 164 51 3 170 3 tsaC Threonylcarbamoyl-AMP synthase Pseudomonas syringae pv. syringae (strain B728a)
B0KF32 6.61e-50 162 50 3 170 3 tsaC Threonylcarbamoyl-AMP synthase Pseudomonas putida (strain GB-1)
Q1QTJ8 8.04e-50 162 43 1 187 3 tsaC Threonylcarbamoyl-AMP synthase Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q9I7A5 9.89e-50 162 49 3 175 3 tsaC Threonylcarbamoyl-AMP synthase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02V59 9.89e-50 162 49 3 175 3 tsaC Threonylcarbamoyl-AMP synthase Pseudomonas aeruginosa (strain UCBPP-PA14)
Q1I2G9 1.08e-49 162 50 3 170 3 tsaC Threonylcarbamoyl-AMP synthase Pseudomonas entomophila (strain L48)
Q4KKQ6 1.2e-49 162 51 3 168 3 tsaC Threonylcarbamoyl-AMP synthase Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q3SG43 2.11e-49 161 45 1 177 3 tsaC Threonylcarbamoyl-AMP synthase Thiobacillus denitrificans (strain ATCC 25259)
B0U4N0 2.23e-49 161 42 1 184 3 tsaC Threonylcarbamoyl-AMP synthase Xylella fastidiosa (strain M12)
Q2SQW8 2.24e-49 161 46 2 177 3 tsaC Threonylcarbamoyl-AMP synthase Hahella chejuensis (strain KCTC 2396)
Q87AQ5 3.76e-49 160 42 1 184 3 tsaC Threonylcarbamoyl-AMP synthase Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2I8S9 3.76e-49 160 42 1 184 3 tsaC Threonylcarbamoyl-AMP synthase Xylella fastidiosa (strain M23)
Q3KKE2 5.71e-49 160 51 3 168 3 tsaC Threonylcarbamoyl-AMP synthase Pseudomonas fluorescens (strain Pf0-1)
B1J499 8.09e-49 159 49 3 170 3 tsaC Threonylcarbamoyl-AMP synthase Pseudomonas putida (strain W619)
B2FIS1 1.71e-48 159 43 1 181 3 tsaC Threonylcarbamoyl-AMP synthase Stenotrophomonas maltophilia (strain K279a)
Q9PEV9 1.82e-48 159 41 1 184 3 tsaC Threonylcarbamoyl-AMP synthase Xylella fastidiosa (strain 9a5c)
A4XNB6 1.93e-48 159 49 3 175 3 tsaC Threonylcarbamoyl-AMP synthase Pseudomonas mendocina (strain ymp)
A6UX84 3.15e-48 158 49 3 175 3 tsaC Threonylcarbamoyl-AMP synthase Pseudomonas aeruginosa (strain PA7)
A1TWN4 2.43e-47 156 48 3 169 3 tsaC Threonylcarbamoyl-AMP synthase Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q83AA2 5.64e-46 152 40 2 186 3 tsaC Threonylcarbamoyl-AMP synthase Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9KH21 9.39e-46 152 40 2 186 3 tsaC Threonylcarbamoyl-AMP synthase Coxiella burnetii (strain Dugway 5J108-111)
A9N9G8 1.82e-45 151 40 2 186 3 tsaC Threonylcarbamoyl-AMP synthase Coxiella burnetii (strain RSA 331 / Henzerling II)
Q21PU1 2.87e-45 150 42 2 189 3 tsaC Threonylcarbamoyl-AMP synthase Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q0A5B4 9.2e-45 149 45 2 176 3 tsaC Threonylcarbamoyl-AMP synthase Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
B0VCB7 4.22e-42 142 42 2 178 3 tsaC Threonylcarbamoyl-AMP synthase Acinetobacter baumannii (strain AYE)
A3M154 4.22e-42 142 42 2 178 3 tsaC Threonylcarbamoyl-AMP synthase Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
B0VNL3 4.22e-42 142 42 2 178 3 tsaC Threonylcarbamoyl-AMP synthase Acinetobacter baumannii (strain SDF)
B2I111 4.22e-42 142 42 2 178 3 tsaC Threonylcarbamoyl-AMP synthase Acinetobacter baumannii (strain ACICU)
Q31JQ7 1.77e-41 141 45 2 168 3 tsaC Threonylcarbamoyl-AMP synthase Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q0VTD8 2.02e-41 140 39 2 175 3 tsaC Threonylcarbamoyl-AMP synthase Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
A6VT87 3.18e-41 140 39 2 182 3 tsaC Threonylcarbamoyl-AMP synthase Marinomonas sp. (strain MWYL1)
Q6FFH9 4.72e-40 137 41 3 181 3 tsaC Threonylcarbamoyl-AMP synthase Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q1Q7W4 3.31e-37 131 41 5 197 3 tsaC Threonylcarbamoyl-AMP synthase Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q7P0L7 3.44e-37 130 38 1 172 3 tsaC Threonylcarbamoyl-AMP synthase Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
A1KWL6 4.96e-36 127 39 2 173 3 tsaC Threonylcarbamoyl-AMP synthase Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
Q9JXA4 4.96e-36 127 39 2 173 3 tsaC Threonylcarbamoyl-AMP synthase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
A1IP83 4.96e-36 127 39 2 173 3 tsaC Threonylcarbamoyl-AMP synthase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
A9M4K6 4.96e-36 127 39 2 173 3 tsaC Threonylcarbamoyl-AMP synthase Neisseria meningitidis serogroup C (strain 053442)
Q4FPS7 4.94e-35 125 38 5 197 3 tsaC Threonylcarbamoyl-AMP synthase Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
Q5F5I5 6.83e-33 119 40 3 174 3 tsaC Threonylcarbamoyl-AMP synthase Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
A5EW39 6.63e-31 114 38 3 169 3 tsaC Threonylcarbamoyl-AMP synthase Dichelobacter nodosus (strain VCS1703A)
D5V9A9 5.62e-30 112 35 3 195 3 tsaC Threonylcarbamoyl-AMP synthase Moraxella catarrhalis (strain BBH18)
C1D9T5 1.74e-27 105 34 2 167 3 tsaC Threonylcarbamoyl-AMP synthase Laribacter hongkongensis (strain HLHK9)
Q9UYB2 2.42e-21 92 32 2 152 1 sua5 Threonylcarbamoyl-AMP synthase Pyrococcus abyssi (strain GE5 / Orsay)
Q970S6 1.15e-18 85 34 4 155 1 sua5 Threonylcarbamoyl-AMP synthase Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7)
P39153 3.08e-18 84 34 6 156 1 ywlC Threonylcarbamoyl-AMP synthase Bacillus subtilis (strain 168)
O94530 7.24e-14 72 27 4 184 3 sua5 Threonylcarbamoyl-AMP synthase Schizosaccharomyces pombe (strain 972 / ATCC 24843)
P32579 8.24e-13 69 26 3 164 1 SUA5 Threonylcarbamoyl-AMP synthase Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q60369 1.27e-10 61 25 3 144 3 MJ0062 Putative threonylcarbamoyl-AMP synthase Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
P0AFR6 1.94e-09 58 25 2 134 3 yciO Uncharacterized protein YciO Shigella flexneri
P0AFR4 1.94e-09 58 25 2 134 1 yciO Uncharacterized protein YciO Escherichia coli (strain K12)
P0AFR5 1.94e-09 58 25 2 134 3 yciO Uncharacterized protein YciO Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P45103 4.51e-09 57 23 4 184 3 HI_1198 Uncharacterized protein HI_1198 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P9WGC9 1.56e-08 55 25 6 177 1 Rv1301 Putative threonylcarbamoyl-AMP synthase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGC8 1.56e-08 55 25 6 177 3 MT1340 Putative threonylcarbamoyl-AMP synthase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q499R4 1.15e-07 53 28 2 163 2 Yrdc Threonylcarbamoyl-AMP synthase Rattus norvegicus
P45831 3.46e-05 46 25 4 132 3 ML1136 Putative threonylcarbamoyl-AMP synthase Mycobacterium leprae (strain TN)
Q0VC80 0.00046 43 26 3 126 2 YRDC Threonylcarbamoyl-AMP synthase Bos taurus
Q3U5F4 0.000473 43 29 3 160 1 Yrdc Threonylcarbamoyl-AMP synthase Mus musculus

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS19100
Feature type CDS
Gene tsaC
Product L-threonylcarbamoyladenylate synthase type 1 TsaC
Location 28087 - 28659 (strand: 1)
Length 573 (nucleotides) / 190 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000011
Length 30728 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2397
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01300 Telomere recombination

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0009 Translation, ribosomal structure and biogenesis (J) J tRNA A37 threonylcarbamoyladenosine synthetase subunit TsaC/SUA5/YrdC

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K07566 L-threonylcarbamoyladenylate synthase [EC:2.7.7.87] - -

Protein Sequence

MNYNDTASNFDGIINVLNNQKVIAYPTEAVFGLGCDPDSEKAVMALLDLKQRPWDKGLILIADNYDQVKPYIDDSRLTTEQRDAMFATWPGPVTWVIPAKSTTPKWLTGRFDSLAVRVTDHPVVKALCSAYGKPVVSTSANLSGYEPCRTTAEVNQQFNGRIPVVDGLVGGRQNPSEIRDALTGQLYRQG

Flanking regions ( +/- flanking 50bp)

TGCGAGTAAAGCCTGCGCAAAACAACAAAAATAACAAAATGAGAAGAATGATGAATTATAATGACACAGCAAGTAATTTTGATGGAATCATAAATGTACTGAATAATCAAAAGGTTATTGCATATCCGACCGAGGCGGTATTCGGCCTGGGTTGTGATCCGGATAGCGAAAAAGCGGTAATGGCATTGCTGGATCTGAAGCAGCGCCCGTGGGATAAAGGCTTAATTTTAATCGCTGATAATTACGATCAGGTAAAACCCTATATTGATGATTCGCGACTGACAACTGAACAACGTGATGCAATGTTTGCAACATGGCCGGGTCCGGTTACCTGGGTTATACCGGCAAAATCAACAACGCCAAAGTGGCTGACCGGGCGTTTTGACTCTCTGGCTGTTCGTGTGACTGACCATCCGGTGGTAAAAGCATTATGCTCAGCCTATGGAAAGCCGGTTGTTTCGACCAGTGCAAATCTGAGCGGTTATGAACCCTGCCGGACAACAGCTGAAGTGAATCAGCAGTTTAACGGACGCATTCCGGTGGTGGATGGTCTGGTCGGCGGGCGACAGAATCCGTCTGAAATCCGTGATGCACTGACCGGGCAGTTATATCGTCAGGGCTGACAGAATACCAAAAGGACCCGGAATGAAAAAATTTGTTGTTTTTGGTCATC