Homologs in group_2408

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_19125 FBDBKF_19125 95.6 Morganella morganii S1 rpsD 30S ribosomal protein S4
EHELCC_18870 EHELCC_18870 95.6 Morganella morganii S2 rpsD 30S ribosomal protein S4
NLDBIP_18885 NLDBIP_18885 95.6 Morganella morganii S4 rpsD 30S ribosomal protein S4
LHKJJB_18740 LHKJJB_18740 95.6 Morganella morganii S3 rpsD 30S ribosomal protein S4
HKOGLL_18475 HKOGLL_18475 95.6 Morganella morganii S5 rpsD 30S ribosomal protein S4
F4V73_RS19040 F4V73_RS19040 95.1 Morganella psychrotolerans rpsD 30S ribosomal protein S4

Distribution of the homologs in the orthogroup group_2408

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2408

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4F1K8 9.5e-152 421 100 0 206 3 rpsD Small ribosomal subunit protein uS4 Proteus mirabilis (strain HI4320)
Q7MYH4 2.48e-149 416 98 0 206 3 rpsD Small ribosomal subunit protein uS4 Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
C6DFS4 1.14e-146 409 95 0 206 3 rpsD Small ribosomal subunit protein uS4 Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q6CZZ4 1.14e-146 409 95 0 206 3 rpsD Small ribosomal subunit protein uS4 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A7MPF7 7.62e-146 407 95 0 206 3 rpsD Small ribosomal subunit protein uS4 Cronobacter sakazakii (strain ATCC BAA-894)
C5BF28 1.21e-145 406 95 0 206 3 rpsD Small ribosomal subunit protein uS4 Edwardsiella ictaluri (strain 93-146)
Q3YWW3 3.66e-145 405 94 0 206 3 rpsD Small ribosomal subunit protein uS4 Shigella sonnei (strain Ss046)
Q0T006 3.66e-145 405 94 0 206 3 rpsD Small ribosomal subunit protein uS4 Shigella flexneri serotype 5b (strain 8401)
Q32B55 3.66e-145 405 94 0 206 3 rpsD Small ribosomal subunit protein uS4 Shigella dysenteriae serotype 1 (strain Sd197)
Q31VY0 3.66e-145 405 94 0 206 3 rpsD Small ribosomal subunit protein uS4 Shigella boydii serotype 4 (strain Sb227)
B2U2R5 3.66e-145 405 94 0 206 3 rpsD Small ribosomal subunit protein uS4 Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B7LRR3 3.66e-145 405 94 0 206 3 rpsD Small ribosomal subunit protein uS4 Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q1R636 3.66e-145 405 94 0 206 3 rpsD Small ribosomal subunit protein uS4 Escherichia coli (strain UTI89 / UPEC)
B1LHB0 3.66e-145 405 94 0 206 3 rpsD Small ribosomal subunit protein uS4 Escherichia coli (strain SMS-3-5 / SECEC)
B6I210 3.66e-145 405 94 0 206 3 rpsD Small ribosomal subunit protein uS4 Escherichia coli (strain SE11)
B7NDR8 3.66e-145 405 94 0 206 3 rpsD Small ribosomal subunit protein uS4 Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A7V8 3.66e-145 405 94 0 206 1 rpsD Small ribosomal subunit protein uS4 Escherichia coli (strain K12)
B1IQ03 3.66e-145 405 94 0 206 3 rpsD Small ribosomal subunit protein uS4 Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0A7V9 3.66e-145 405 94 0 206 3 rpsD Small ribosomal subunit protein uS4 Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TCG5 3.66e-145 405 94 0 206 3 rpsD Small ribosomal subunit protein uS4 Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AGI7 3.66e-145 405 94 0 206 3 rpsD Small ribosomal subunit protein uS4 Escherichia coli O1:K1 / APEC
A8A5A1 3.66e-145 405 94 0 206 3 rpsD Small ribosomal subunit protein uS4 Escherichia coli O9:H4 (strain HS)
B1X6E8 3.66e-145 405 94 0 206 3 rpsD Small ribosomal subunit protein uS4 Escherichia coli (strain K12 / DH10B)
C4ZUF1 3.66e-145 405 94 0 206 3 rpsD Small ribosomal subunit protein uS4 Escherichia coli (strain K12 / MC4100 / BW2952)
B7M102 3.66e-145 405 94 0 206 3 rpsD Small ribosomal subunit protein uS4 Escherichia coli O8 (strain IAI1)
B7N181 3.66e-145 405 94 0 206 3 rpsD Small ribosomal subunit protein uS4 Escherichia coli O81 (strain ED1a)
B7NLL6 3.66e-145 405 94 0 206 3 rpsD Small ribosomal subunit protein uS4 Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5YT15 3.66e-145 405 94 0 206 3 rpsD Small ribosomal subunit protein uS4 Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A7W0 3.66e-145 405 94 0 206 3 rpsD Small ribosomal subunit protein uS4 Escherichia coli O157:H7
B7LHZ8 3.66e-145 405 94 0 206 3 rpsD Small ribosomal subunit protein uS4 Escherichia coli (strain 55989 / EAEC)
B7MCR2 3.66e-145 405 94 0 206 3 rpsD Small ribosomal subunit protein uS4 Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UK20 3.66e-145 405 94 0 206 3 rpsD Small ribosomal subunit protein uS4 Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZSI5 3.66e-145 405 94 0 206 3 rpsD Small ribosomal subunit protein uS4 Escherichia coli O139:H28 (strain E24377A / ETEC)
A8AQJ1 3.66e-145 405 94 0 206 3 rpsD Small ribosomal subunit protein uS4 Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
B1JJG9 3.82e-145 405 94 0 206 3 rpsD Small ribosomal subunit protein uS4 Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q664U5 3.82e-145 405 94 0 206 3 rpsD Small ribosomal subunit protein uS4 Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TH14 3.82e-145 405 94 0 206 3 rpsD Small ribosomal subunit protein uS4 Yersinia pestis (strain Pestoides F)
Q1CCW7 3.82e-145 405 94 0 206 3 rpsD Small ribosomal subunit protein uS4 Yersinia pestis bv. Antiqua (strain Nepal516)
A9R917 3.82e-145 405 94 0 206 3 rpsD Small ribosomal subunit protein uS4 Yersinia pestis bv. Antiqua (strain Angola)
Q8ZJ88 3.82e-145 405 94 0 206 3 rpsD Small ribosomal subunit protein uS4 Yersinia pestis
B2K513 3.82e-145 405 94 0 206 3 rpsD Small ribosomal subunit protein uS4 Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C2X0 3.82e-145 405 94 0 206 3 rpsD Small ribosomal subunit protein uS4 Yersinia pestis bv. Antiqua (strain Antiqua)
A7FNL1 3.82e-145 405 94 0 206 3 rpsD Small ribosomal subunit protein uS4 Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A1JS02 3.82e-145 405 94 0 206 3 rpsD Small ribosomal subunit protein uS4 Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
B2VK72 8.9e-145 404 93 0 206 3 rpsD Small ribosomal subunit protein uS4 Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
Q2NQP6 9.09e-145 404 93 0 206 3 rpsD Small ribosomal subunit protein uS4 Sodalis glossinidius (strain morsitans)
O54297 1.35e-144 404 94 0 206 1 rpsD Small ribosomal subunit protein uS4 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B4TXB9 1.35e-144 404 94 0 206 3 rpsD Small ribosomal subunit protein uS4 Salmonella schwarzengrund (strain CVM19633)
Q5PK09 1.35e-144 404 94 0 206 3 rpsD Small ribosomal subunit protein uS4 Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4SUR7 1.35e-144 404 94 0 206 3 rpsD Small ribosomal subunit protein uS4 Salmonella newport (strain SL254)
B4TJY6 1.35e-144 404 94 0 206 3 rpsD Small ribosomal subunit protein uS4 Salmonella heidelberg (strain SL476)
B5RH39 1.35e-144 404 94 0 206 3 rpsD Small ribosomal subunit protein uS4 Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R1F3 1.35e-144 404 94 0 206 3 rpsD Small ribosomal subunit protein uS4 Salmonella enteritidis PT4 (strain P125109)
B5FJJ1 1.35e-144 404 94 0 206 3 rpsD Small ribosomal subunit protein uS4 Salmonella dublin (strain CT_02021853)
Q57J55 1.35e-144 404 94 0 206 3 rpsD Small ribosomal subunit protein uS4 Salmonella choleraesuis (strain SC-B67)
A9MN71 1.35e-144 404 94 0 206 3 rpsD Small ribosomal subunit protein uS4 Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B5F7S2 1.35e-144 404 94 0 206 3 rpsD Small ribosomal subunit protein uS4 Salmonella agona (strain SL483)
B5BGW2 1.86e-144 403 93 0 206 3 rpsD Small ribosomal subunit protein uS4 Salmonella paratyphi A (strain AKU_12601)
A8GKH4 3.58e-144 402 93 0 206 3 rpsD Small ribosomal subunit protein uS4 Serratia proteamaculans (strain 568)
P59132 7.31e-144 402 94 0 206 3 rpsD Small ribosomal subunit protein uS4 Shigella flexneri
Q8Z1X4 2.12e-143 400 93 0 206 3 rpsD Small ribosomal subunit protein uS4 Salmonella typhi
A6TEU9 6.78e-143 399 93 0 206 3 rpsD Small ribosomal subunit protein uS4 Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5XNB5 6.78e-143 399 93 0 206 3 rpsD Small ribosomal subunit protein uS4 Klebsiella pneumoniae (strain 342)
A4WFA4 8.09e-142 396 92 0 206 3 rpsD Small ribosomal subunit protein uS4 Enterobacter sp. (strain 638)
B0UX38 3.49e-139 390 90 0 206 3 rpsD Small ribosomal subunit protein uS4 Histophilus somni (strain 2336)
A5UHV4 7.44e-139 389 89 0 206 3 rpsD Small ribosomal subunit protein uS4 Haemophilus influenzae (strain PittGG)
A5UDS3 7.44e-139 389 89 0 206 3 rpsD Small ribosomal subunit protein uS4 Haemophilus influenzae (strain PittEE)
Q4QM98 7.44e-139 389 89 0 206 3 rpsD Small ribosomal subunit protein uS4 Haemophilus influenzae (strain 86-028NP)
Q65QX9 9.17e-139 389 90 0 206 3 rpsD Small ribosomal subunit protein uS4 Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q0I138 9.68e-139 389 90 0 206 3 rpsD Small ribosomal subunit protein uS4 Histophilus somni (strain 129Pt)
Q9CL53 9.79e-139 389 90 0 206 3 rpsD Small ribosomal subunit protein uS4 Pasteurella multocida (strain Pm70)
P44373 3.57e-138 387 89 0 206 3 rpsD Small ribosomal subunit protein uS4 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A6VLL2 1.25e-137 386 88 0 206 3 rpsD Small ribosomal subunit protein uS4 Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
B8F6P7 9.4e-136 381 88 0 206 3 rpsD Small ribosomal subunit protein uS4 Glaesserella parasuis serovar 5 (strain SH0165)
A3Q9A6 1.61e-134 378 87 0 206 3 rpsD Small ribosomal subunit protein uS4 Shewanella loihica (strain ATCC BAA-1088 / PV-4)
A1S242 3.11e-134 377 86 0 206 3 rpsD Small ribosomal subunit protein uS4 Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
A0KRP8 6.28e-134 377 86 0 206 3 rpsD Small ribosomal subunit protein uS4 Shewanella sp. (strain ANA-3)
Q0I081 1.1e-133 376 86 0 206 3 rpsD Small ribosomal subunit protein uS4 Shewanella sp. (strain MR-7)
Q0HNR3 1.1e-133 376 86 0 206 3 rpsD Small ribosomal subunit protein uS4 Shewanella sp. (strain MR-4)
P59131 1.1e-133 376 86 0 206 3 rpsD Small ribosomal subunit protein uS4 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
C4L7V4 5.82e-133 374 85 0 206 3 rpsD Small ribosomal subunit protein uS4 Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
Q7VKF7 7.2e-133 374 87 1 208 3 rpsD Small ribosomal subunit protein uS4 Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q089N0 9.74e-133 374 85 0 206 3 rpsD Small ribosomal subunit protein uS4 Shewanella frigidimarina (strain NCIMB 400)
B0BSV5 1.01e-132 374 87 1 208 3 rpsD Small ribosomal subunit protein uS4 Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B3GZ35 1.01e-132 374 87 1 208 3 rpsD Small ribosomal subunit protein uS4 Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3N381 1.01e-132 374 87 1 208 3 rpsD Small ribosomal subunit protein uS4 Actinobacillus pleuropneumoniae serotype 5b (strain L20)
A1RED8 1.09e-132 373 85 0 206 3 rpsD Small ribosomal subunit protein uS4 Shewanella sp. (strain W3-18-1)
A4YBV9 1.09e-132 373 85 0 206 3 rpsD Small ribosomal subunit protein uS4 Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
A4SSY2 1.67e-132 373 85 0 206 3 rpsD Small ribosomal subunit protein uS4 Aeromonas salmonicida (strain A449)
A0KF44 3.96e-132 372 85 0 206 3 rpsD Small ribosomal subunit protein uS4 Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
B7VLD3 5.27e-132 372 84 0 206 3 rpsD Small ribosomal subunit protein uS4 Vibrio atlanticus (strain LGP32)
B5FGE0 8.64e-132 371 84 0 206 3 rpsD Small ribosomal subunit protein uS4 Aliivibrio fischeri (strain MJ11)
Q5E890 8.64e-132 371 84 0 206 3 rpsD Small ribosomal subunit protein uS4 Aliivibrio fischeri (strain ATCC 700601 / ES114)
A9KWC5 1.1e-131 371 85 0 206 3 rpsD Small ribosomal subunit protein uS4 Shewanella baltica (strain OS195)
A6WHV2 1.1e-131 371 85 0 206 3 rpsD Small ribosomal subunit protein uS4 Shewanella baltica (strain OS185)
A3DA48 1.1e-131 371 85 0 206 3 rpsD Small ribosomal subunit protein uS4 Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8EBI1 1.1e-131 371 85 0 206 3 rpsD Small ribosomal subunit protein uS4 Shewanella baltica (strain OS223)
Q12ST5 2.42e-131 370 84 0 206 3 rpsD Small ribosomal subunit protein uS4 Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
B6EPU8 5.22e-131 369 83 0 206 3 rpsD Small ribosomal subunit protein uS4 Aliivibrio salmonicida (strain LFI1238)
C3LRN4 6.29e-131 369 85 0 206 3 rpsD Small ribosomal subunit protein uS4 Vibrio cholerae serotype O1 (strain M66-2)
Q9KP07 6.29e-131 369 85 0 206 3 rpsD Small ribosomal subunit protein uS4 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F573 6.29e-131 369 85 0 206 3 rpsD Small ribosomal subunit protein uS4 Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q7MPG5 7.92e-131 369 84 0 206 3 rpsD Small ribosomal subunit protein uS4 Vibrio vulnificus (strain YJ016)
Q8DE62 7.92e-131 369 84 0 206 3 rpsD Small ribosomal subunit protein uS4 Vibrio vulnificus (strain CMCP6)
Q87SZ1 8.74e-131 369 84 0 206 3 rpsD Small ribosomal subunit protein uS4 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
A7N0H7 8.74e-131 369 84 0 206 3 rpsD Small ribosomal subunit protein uS4 Vibrio campbellii (strain ATCC BAA-1116)
B8CNF7 1.09e-130 368 85 0 206 3 rpsD Small ribosomal subunit protein uS4 Shewanella piezotolerans (strain WP3 / JCM 13877)
A8GYZ9 1.09e-130 368 85 0 206 3 rpsD Small ribosomal subunit protein uS4 Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
B0TLY9 1.09e-130 368 85 0 206 3 rpsD Small ribosomal subunit protein uS4 Shewanella halifaxensis (strain HAW-EB4)
A8G1C6 2.95e-130 367 84 0 206 3 rpsD Small ribosomal subunit protein uS4 Shewanella sediminis (strain HAW-EB3)
B4RT52 4.1e-130 367 84 0 206 3 rpsD Small ribosomal subunit protein uS4 Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
B1KM36 8.74e-130 366 84 0 206 3 rpsD Small ribosomal subunit protein uS4 Shewanella woodyi (strain ATCC 51908 / MS32)
Q6LV92 1.24e-129 365 83 0 206 3 rpsD Small ribosomal subunit protein uS4 Photobacterium profundum (strain SS9)
Q1LTB4 1.53e-129 365 83 0 206 3 rpsD Small ribosomal subunit protein uS4 Baumannia cicadellinicola subsp. Homalodisca coagulata
Q3IJJ5 1.78e-128 363 84 0 206 3 rpsD Small ribosomal subunit protein uS4 Pseudoalteromonas translucida (strain TAC 125)
Q15X49 2.74e-127 360 82 0 206 3 rpsD Small ribosomal subunit protein uS4 Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q5QXV7 3.09e-127 360 83 0 206 3 rpsD Small ribosomal subunit protein uS4 Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q9S0Q9 9.35e-126 356 82 0 206 3 rpsD Small ribosomal subunit protein uS4 Shewanella violacea
B8D825 1.1e-124 353 79 0 206 3 rpsD Small ribosomal subunit protein uS4 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
P57567 1.1e-124 353 79 0 206 3 rpsD Small ribosomal subunit protein uS4 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B8D9S3 1.1e-124 353 79 0 206 3 rpsD Small ribosomal subunit protein uS4 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
A1SXW7 1.65e-124 353 80 0 206 3 rpsD1 Small ribosomal subunit protein uS4A Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
A1T0B8 2.57e-124 352 79 0 206 3 rpsD2 Small ribosomal subunit protein uS4B Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
P41186 2.86e-124 352 80 0 206 3 rpsD Small ribosomal subunit protein uS4 Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q2S936 5.59e-119 339 78 0 206 3 rpsD Small ribosomal subunit protein uS4 Hahella chejuensis (strain KCTC 2396)
P59491 7.35e-119 338 75 0 206 3 rpsD Small ribosomal subunit protein uS4 Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q493I5 2.02e-118 337 76 1 207 3 rpsD Small ribosomal subunit protein uS4 Blochmanniella pennsylvanica (strain BPEN)
C4K794 5.28e-117 334 77 0 206 3 rpsD Small ribosomal subunit protein uS4 Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
B8GV34 1.42e-115 330 77 0 206 3 rpsD Small ribosomal subunit protein uS4 Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
A1TYM1 2.34e-115 330 76 0 206 3 rpsD Small ribosomal subunit protein uS4 Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q7NQH6 3.36e-114 327 75 0 206 3 rpsD Small ribosomal subunit protein uS4 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q488Y9 6.71e-114 326 81 0 206 3 rpsD Small ribosomal subunit protein uS4 Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
B3PK61 8.72e-113 323 74 0 206 3 rpsD Small ribosomal subunit protein uS4 Cellvibrio japonicus (strain Ueda107)
C5BQ85 3.95e-111 319 74 0 206 3 rpsD Small ribosomal subunit protein uS4 Teredinibacter turnerae (strain ATCC 39867 / T7901)
Q7VQC4 7.65e-111 318 71 1 207 3 rpsD Small ribosomal subunit protein uS4 Blochmanniella floridana
Q21M34 1.46e-110 317 73 0 206 3 rpsD Small ribosomal subunit protein uS4 Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
A6UZL2 1.49e-110 317 74 0 206 3 rpsD Small ribosomal subunit protein uS4 Pseudomonas aeruginosa (strain PA7)
O52759 3.95e-110 316 74 0 206 1 rpsD Small ribosomal subunit protein uS4 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02T56 3.95e-110 316 74 0 206 3 rpsD Small ribosomal subunit protein uS4 Pseudomonas aeruginosa (strain UCBPP-PA14)
B7V667 3.95e-110 316 74 0 206 3 rpsD Small ribosomal subunit protein uS4 Pseudomonas aeruginosa (strain LESB58)
Q8D1Y9 1.09e-109 315 70 0 206 3 rpsD Small ribosomal subunit protein uS4 Wigglesworthia glossinidia brevipalpis
C1DAU2 1.57e-109 315 72 0 206 3 rpsD Small ribosomal subunit protein uS4 Laribacter hongkongensis (strain HLHK9)
A1WV98 2.24e-109 315 72 1 207 3 rpsD Small ribosomal subunit protein uS4 Halorhodospira halophila (strain DSM 244 / SL1)
Q31IV9 2.41e-109 314 72 0 206 3 rpsD Small ribosomal subunit protein uS4 Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
C1DKN7 6.6e-109 313 73 0 206 3 rpsD Small ribosomal subunit protein uS4 Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
Q1R0F1 9.8e-109 313 75 0 206 3 rpsD Small ribosomal subunit protein uS4 Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q1IFU2 1.1e-108 313 73 0 206 3 rpsD Small ribosomal subunit protein uS4 Pseudomonas entomophila (strain L48)
Q3J8T7 1.25e-108 313 70 1 208 3 rpsD Small ribosomal subunit protein uS4 Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
B0KK90 2.2e-108 312 73 0 206 3 rpsD Small ribosomal subunit protein uS4 Pseudomonas putida (strain GB-1)
A4XZ66 2.43e-108 312 74 0 206 3 rpsD Small ribosomal subunit protein uS4 Pseudomonas mendocina (strain ymp)
Q88QL2 3.53e-108 311 73 0 206 3 rpsD Small ribosomal subunit protein uS4 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
A5VXS1 3.53e-108 311 73 0 206 3 rpsD Small ribosomal subunit protein uS4 Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
B1JAI8 7.94e-108 310 73 0 206 3 rpsD Small ribosomal subunit protein uS4 Pseudomonas putida (strain W619)
Q605D6 2.4e-107 309 68 0 206 3 rpsD Small ribosomal subunit protein uS4 Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
A4VHQ4 3.37e-107 309 72 0 206 3 rpsD Small ribosomal subunit protein uS4 Stutzerimonas stutzeri (strain A1501)
A1KRJ8 9.35e-107 308 72 0 206 3 rpsD Small ribosomal subunit protein uS4 Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
P66561 9.35e-107 308 72 0 206 3 rpsD Small ribosomal subunit protein uS4 Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
P66560 9.35e-107 308 72 0 206 3 rpsD Small ribosomal subunit protein uS4 Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
A9M3U1 9.35e-107 308 72 0 206 3 rpsD Small ribosomal subunit protein uS4 Neisseria meningitidis serogroup C (strain 053442)
Q5F5V1 9.35e-107 308 72 0 206 3 rpsD Small ribosomal subunit protein uS4 Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
A1AVM4 1.77e-106 307 69 1 208 3 rpsD Small ribosomal subunit protein uS4 Ruthia magnifica subsp. Calyptogena magnifica
Q3K611 1.8e-106 307 72 0 206 3 rpsD Small ribosomal subunit protein uS4 Pseudomonas fluorescens (strain Pf0-1)
Q057C8 3.64e-106 306 67 0 206 3 rpsD Small ribosomal subunit protein uS4 Buchnera aphidicola subsp. Cinara cedri (strain Cc)
A5EX95 4.1e-106 306 71 0 206 3 rpsD Small ribosomal subunit protein uS4 Dichelobacter nodosus (strain VCS1703A)
C3K2V2 7.49e-106 305 72 0 206 3 rpsD Small ribosomal subunit protein uS4 Pseudomonas fluorescens (strain SBW25)
A6W368 8e-106 305 70 0 206 3 rpsD Small ribosomal subunit protein uS4 Marinomonas sp. (strain MWYL1)
Q4ZMR7 1.63e-105 305 71 0 206 3 rpsD Small ribosomal subunit protein uS4 Pseudomonas syringae pv. syringae (strain B728a)
Q889U7 1.63e-105 305 71 0 206 3 rpsD Small ribosomal subunit protein uS4 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q48D60 1.63e-105 305 71 0 206 3 rpsD Small ribosomal subunit protein uS4 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q4K556 2.1e-105 304 71 0 206 3 rpsD Small ribosomal subunit protein uS4 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
A4G9R4 4.06e-105 304 70 1 207 3 rpsD Small ribosomal subunit protein uS4 Herminiimonas arsenicoxydans
A5CXI8 1.97e-104 302 68 1 208 3 rpsD Small ribosomal subunit protein uS4 Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA)
A6T3H9 3.71e-104 301 70 1 207 3 rpsD Small ribosomal subunit protein uS4 Janthinobacterium sp. (strain Marseille)
Q0VSH9 3.98e-104 301 70 1 210 3 rpsD Small ribosomal subunit protein uS4 Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q2SU52 6.21e-104 301 71 1 207 3 rpsD Small ribosomal subunit protein uS4 Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q0ABF1 8.61e-104 300 69 0 206 3 rpsD Small ribosomal subunit protein uS4 Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q5NHU4 9.82e-104 300 69 0 206 3 rpsD Small ribosomal subunit protein uS4 Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
A0Q4K7 9.82e-104 300 69 0 206 3 rpsD Small ribosomal subunit protein uS4 Francisella tularensis subsp. novicida (strain U112)
Q2A5E6 9.82e-104 300 69 0 206 3 rpsD Small ribosomal subunit protein uS4 Francisella tularensis subsp. holarctica (strain LVS)
A7N9U8 9.82e-104 300 69 0 206 3 rpsD Small ribosomal subunit protein uS4 Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
Q14J96 9.82e-104 300 69 0 206 3 rpsD Small ribosomal subunit protein uS4 Francisella tularensis subsp. tularensis (strain FSC 198)
A4IZR0 9.93e-104 300 69 0 206 3 rpsD Small ribosomal subunit protein uS4 Francisella tularensis subsp. tularensis (strain WY96-3418)
Q13TJ5 1.12e-103 300 71 1 207 3 rpsD Small ribosomal subunit protein uS4 Paraburkholderia xenovorans (strain LB400)
Q0BNQ4 2.14e-103 299 69 0 206 3 rpsD Small ribosomal subunit protein uS4 Francisella tularensis subsp. holarctica (strain OSU18)
B0U0W6 2.55e-103 299 69 0 206 3 rpsD Small ribosomal subunit protein uS4 Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
B2SDW1 3.42e-103 299 68 0 206 3 rpsD Small ribosomal subunit protein uS4 Francisella tularensis subsp. mediasiatica (strain FSC147)
B3R7E4 5.03e-103 298 69 1 207 3 rpsD Small ribosomal subunit protein uS4 Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
B2T726 8.15e-103 298 71 1 207 3 rpsD Small ribosomal subunit protein uS4 Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
B1YRQ4 8.8e-103 298 70 1 207 3 rpsD Small ribosomal subunit protein uS4 Burkholderia ambifaria (strain MC40-6)
Q0K644 9.29e-103 298 69 1 207 3 rpsD Small ribosomal subunit protein uS4 Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q0BJ21 1.29e-102 297 69 1 207 3 rpsD Small ribosomal subunit protein uS4 Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
Q1LI62 1.33e-102 297 70 1 207 3 rpsD Small ribosomal subunit protein uS4 Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
A4JAR5 1.66e-102 297 69 1 207 3 rpsD Small ribosomal subunit protein uS4 Burkholderia vietnamiensis (strain G4 / LMG 22486)
Q63Q36 1.68e-102 297 70 1 207 3 rpsD Small ribosomal subunit protein uS4 Burkholderia pseudomallei (strain K96243)
A3NEF4 1.68e-102 297 70 1 207 3 rpsD Small ribosomal subunit protein uS4 Burkholderia pseudomallei (strain 668)
Q3JMT8 1.68e-102 297 70 1 207 3 rpsD Small ribosomal subunit protein uS4 Burkholderia pseudomallei (strain 1710b)
A1V878 1.68e-102 297 70 1 207 3 rpsD Small ribosomal subunit protein uS4 Burkholderia mallei (strain SAVP1)
Q62GN0 1.68e-102 297 70 1 207 3 rpsD Small ribosomal subunit protein uS4 Burkholderia mallei (strain ATCC 23344)
A2S7K1 1.68e-102 297 70 1 207 3 rpsD Small ribosomal subunit protein uS4 Burkholderia mallei (strain NCTC 10229)
A3MRX9 1.68e-102 297 70 1 207 3 rpsD Small ribosomal subunit protein uS4 Burkholderia mallei (strain NCTC 10247)
A9ADL8 1.79e-102 297 69 1 207 3 rpsD Small ribosomal subunit protein uS4 Burkholderia multivorans (strain ATCC 17616 / 249)
A3P088 3.03e-102 296 70 1 207 3 rpsD Small ribosomal subunit protein uS4 Burkholderia pseudomallei (strain 1106a)
Q46WG8 5.24e-102 296 69 1 207 3 rpsD Small ribosomal subunit protein uS4 Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q39KE2 5.73e-102 296 69 1 207 3 rpsD Small ribosomal subunit protein uS4 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q1BRX3 6.05e-102 296 69 1 207 3 rpsD Small ribosomal subunit protein uS4 Burkholderia orbicola (strain AU 1054)
B1JU47 6.05e-102 296 69 1 207 3 rpsD Small ribosomal subunit protein uS4 Burkholderia orbicola (strain MC0-3)
B4E5E5 6.05e-102 296 69 1 207 3 rpsD Small ribosomal subunit protein uS4 Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
A0K3Q0 6.05e-102 296 69 1 207 3 rpsD Small ribosomal subunit protein uS4 Burkholderia cenocepacia (strain HI2424)
B2JI40 8.13e-102 295 70 1 207 3 rpsD Small ribosomal subunit protein uS4 Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
Q8XV37 1.36e-101 295 69 1 207 3 rpsD Small ribosomal subunit protein uS4 Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
B2UEJ4 4.16e-101 293 69 1 207 3 rpsD Small ribosomal subunit protein uS4 Ralstonia pickettii (strain 12J)
B9MBW1 5.23e-101 293 70 1 207 3 rpsD Small ribosomal subunit protein uS4 Acidovorax ebreus (strain TPSY)
A1TJU1 6.81e-101 293 69 1 207 3 rpsD Small ribosomal subunit protein uS4 Paracidovorax citrulli (strain AAC00-1)
A1W332 1.82e-100 292 69 1 207 3 rpsD Small ribosomal subunit protein uS4 Acidovorax sp. (strain JS42)
A4SUY5 2.22e-100 291 69 1 207 3 rpsD Small ribosomal subunit protein uS4 Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)
Q5GWV8 4.95e-100 291 65 2 208 3 rpsD Small ribosomal subunit protein uS4 Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
B2SQT3 4.95e-100 291 65 2 208 3 rpsD Small ribosomal subunit protein uS4 Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q2P008 4.95e-100 291 65 2 208 3 rpsD Small ribosomal subunit protein uS4 Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
B0V6U6 7.42e-100 290 70 2 208 3 rpsD Small ribosomal subunit protein uS4 Acinetobacter baumannii (strain AYE)
A3M960 7.42e-100 290 70 2 208 3 rpsD Small ribosomal subunit protein uS4 Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
B0VQU2 7.42e-100 290 70 2 208 3 rpsD Small ribosomal subunit protein uS4 Acinetobacter baumannii (strain SDF)
B7IA15 7.42e-100 290 70 2 208 1 rpsD Small ribosomal subunit protein uS4 Acinetobacter baumannii (strain AB0057)
B7GW26 7.42e-100 290 70 2 208 3 rpsD Small ribosomal subunit protein uS4 Acinetobacter baumannii (strain AB307-0294)
B2HZ84 8.01e-100 290 70 2 208 3 rpsD Small ribosomal subunit protein uS4 Acinetobacter baumannii (strain ACICU)
Q5WZI8 9.11e-100 290 66 0 206 3 rpsD Small ribosomal subunit protein uS4 Legionella pneumophila (strain Lens)
Q5ZYL9 9.11e-100 290 66 0 206 3 rpsD Small ribosomal subunit protein uS4 Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
A5IHP2 9.11e-100 290 66 0 206 3 rpsD Small ribosomal subunit protein uS4 Legionella pneumophila (strain Corby)
Q3BWW0 9.55e-100 290 65 2 208 3 rpsD Small ribosomal subunit protein uS4 Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
P0A0X9 9.55e-100 290 65 2 208 3 rpsD Small ribosomal subunit protein uS4 Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RU59 9.55e-100 290 65 2 208 3 rpsD Small ribosomal subunit protein uS4 Xanthomonas campestris pv. campestris (strain B100)
Q4URG2 9.55e-100 290 65 2 208 3 rpsD Small ribosomal subunit protein uS4 Xanthomonas campestris pv. campestris (strain 8004)
P0A0Y0 9.55e-100 290 65 2 208 3 rpsD Small ribosomal subunit protein uS4 Xanthomonas axonopodis pv. citri (strain 306)
Q5X835 1.21e-99 290 65 0 206 3 rpsD Small ribosomal subunit protein uS4 Legionella pneumophila (strain Paris)
B2FQK7 1.65e-99 290 66 2 209 3 rpsD Small ribosomal subunit protein uS4 Stenotrophomonas maltophilia (strain K279a)
B4SLH4 1.65e-99 290 66 2 209 3 rpsD Small ribosomal subunit protein uS4 Stenotrophomonas maltophilia (strain R551-3)
Q12G78 2.53e-99 289 67 1 207 3 rpsD Small ribosomal subunit protein uS4 Polaromonas sp. (strain JS666 / ATCC BAA-500)
Q6F7T6 4.72e-99 288 68 1 207 3 rpsD Small ribosomal subunit protein uS4 Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
A1VJ39 5.62e-99 288 67 1 207 3 rpsD Small ribosomal subunit protein uS4 Polaromonas naphthalenivorans (strain CJ2)
C5CQ76 6e-99 288 67 1 207 3 rpsD Small ribosomal subunit protein uS4 Variovorax paradoxus (strain S110)
Q21QP8 4.91e-98 286 66 1 207 3 rpsD Small ribosomal subunit protein uS4 Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
B1XSS6 8.31e-98 285 67 1 207 3 rpsD Small ribosomal subunit protein uS4 Polynucleobacter necessarius subsp. necessarius (strain STIR1)
Q83EQ3 8.1e-97 283 65 0 206 3 rpsD Small ribosomal subunit protein uS4 Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9NAZ4 8.1e-97 283 65 0 206 3 rpsD Small ribosomal subunit protein uS4 Coxiella burnetii (strain RSA 331 / Henzerling II)
A9KD07 8.1e-97 283 65 0 206 3 rpsD Small ribosomal subunit protein uS4 Coxiella burnetii (strain Dugway 5J108-111)
B6J239 8.1e-97 283 65 0 206 3 rpsD Small ribosomal subunit protein uS4 Coxiella burnetii (strain CbuG_Q212)
B6J5F6 9.13e-97 283 65 0 206 3 rpsD Small ribosomal subunit protein uS4 Coxiella burnetii (strain CbuK_Q154)
P0A4C5 1.99e-96 282 63 1 207 3 rpsD Small ribosomal subunit protein uS4 Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
P0A4C7 1.99e-96 282 63 1 207 3 rpsD Small ribosomal subunit protein uS4 Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
P0A4C6 1.99e-96 282 63 1 207 3 rpsD Small ribosomal subunit protein uS4 Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
A9IHR7 2.27e-96 281 64 1 207 3 rpsD Small ribosomal subunit protein uS4 Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
A2SLD2 3.4e-96 281 69 1 207 3 rpsD Small ribosomal subunit protein uS4 Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
A1WK93 4.38e-96 281 67 1 207 3 rpsD Small ribosomal subunit protein uS4 Verminephrobacter eiseniae (strain EF01-2)
A9BRX4 7.24e-96 280 67 1 207 3 rpsD Small ribosomal subunit protein uS4 Delftia acidovorans (strain DSM 14801 / SPH-1)
Q87E60 1.94e-94 277 63 2 208 3 rpsD Small ribosomal subunit protein uS4 Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2I8J2 1.94e-94 277 63 2 208 3 rpsD Small ribosomal subunit protein uS4 Xylella fastidiosa (strain M23)
B0U5M2 3.78e-94 276 62 2 208 3 rpsD Small ribosomal subunit protein uS4 Xylella fastidiosa (strain M12)
Q2L242 5.72e-94 275 62 1 207 3 rpsD Small ribosomal subunit protein uS4 Bordetella avium (strain 197N)
Q9PE53 1.79e-93 274 63 2 208 3 rpsD Small ribosomal subunit protein uS4 Xylella fastidiosa (strain 9a5c)
B1Y7N0 4.29e-93 273 67 1 207 3 rpsD Small ribosomal subunit protein uS4 Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)
Q4FUD2 2.46e-92 271 64 3 213 3 rpsD Small ribosomal subunit protein uS4 Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
Q1QDG2 2.77e-92 271 64 3 213 3 rpsD Small ribosomal subunit protein uS4 Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
A5WCL3 6.92e-91 268 64 3 213 3 rpsD Small ribosomal subunit protein uS4 Psychrobacter sp. (strain PRwf-1)
Q2YAX3 5.8e-89 263 63 2 209 3 rpsD Small ribosomal subunit protein uS4 Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
A0L5Z7 2.23e-88 261 62 2 209 3 rpsD Small ribosomal subunit protein uS4 Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
A1KB02 2.11e-84 251 61 3 210 3 rpsD Small ribosomal subunit protein uS4 Azoarcus sp. (strain BH72)
Q0AIH2 2.35e-82 246 58 2 209 3 rpsD Small ribosomal subunit protein uS4 Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
Q3SLM5 6e-81 243 60 3 210 3 rpsD Small ribosomal subunit protein uS4 Thiobacillus denitrificans (strain ATCC 25259)
Q82X70 8.05e-81 242 56 2 209 3 rpsD1 Small ribosomal subunit protein uS4A Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q5P308 1.12e-79 239 59 3 210 3 rpsD Small ribosomal subunit protein uS4 Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q47J78 3.03e-77 233 56 3 210 3 rpsD Small ribosomal subunit protein uS4 Dechloromonas aromatica (strain RCB)
B5YG23 4.29e-77 233 55 2 209 3 rpsD Small ribosomal subunit protein uS4 Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87)
Q2RFS5 3.32e-75 228 55 2 209 3 rpsD Small ribosomal subunit protein uS4 Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
Q39XY0 6.76e-75 227 54 2 209 3 rpsD Small ribosomal subunit protein uS4 Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
Q749B2 8.69e-75 227 55 2 209 3 rpsD Small ribosomal subunit protein uS4 Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
B9M6F3 1.91e-74 226 55 2 209 3 rpsD Small ribosomal subunit protein uS4 Geotalea daltonii (strain DSM 22248 / JCM 15807 / FRC-32)
A5GAU5 3.23e-74 226 55 2 209 3 rpsD Small ribosomal subunit protein uS4 Geotalea uraniireducens (strain Rf4)
B2TIK3 7.32e-74 224 55 3 209 3 rpsD Small ribosomal subunit protein uS4 Clostridium botulinum (strain Eklund 17B / Type B)
B2UYD8 7.32e-74 224 55 3 209 3 rpsD Small ribosomal subunit protein uS4 Clostridium botulinum (strain Alaska E43 / Type E3)
C6E4N1 1.1e-73 224 55 2 209 3 rpsD Small ribosomal subunit protein uS4 Geobacter sp. (strain M21)
B9L6T8 2.07e-73 223 54 2 209 3 rpsD Small ribosomal subunit protein uS4 Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH)
B3E856 2.3e-73 223 54 2 209 3 rpsD Small ribosomal subunit protein uS4 Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)
B5EFS6 3.1e-73 223 54 2 209 3 rpsD Small ribosomal subunit protein uS4 Citrifermentans bemidjiense (strain ATCC BAA-1014 / DSM 16622 / JCM 12645 / Bem)
A6LPT9 3.73e-73 223 54 3 209 3 rpsD Small ribosomal subunit protein uS4 Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
A0PXX4 3.77e-73 223 55 3 209 3 rpsD1 Small ribosomal subunit protein uS4A Clostridium novyi (strain NT)
B2A4P9 2.47e-72 221 59 3 210 3 rpsD Small ribosomal subunit protein uS4 Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF)
Q8R7Y1 3.46e-72 220 54 3 209 3 rpsD Small ribosomal subunit protein uS4 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
A4XLQ3 3.99e-72 220 54 2 209 3 rpsD Small ribosomal subunit protein uS4 Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331)
A7GJ46 5.78e-72 219 54 3 209 3 rpsD1 Small ribosomal subunit protein uS4A Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)
A5I7H8 5.78e-72 219 54 3 209 3 rpsD1 Small ribosomal subunit protein uS4A Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)
A7FZ45 5.78e-72 219 54 3 209 3 rpsD1 Small ribosomal subunit protein uS4A Clostridium botulinum (strain ATCC 19397 / Type A)
B0K5S0 7.85e-72 219 55 3 209 3 rpsD Small ribosomal subunit protein uS4 Thermoanaerobacter sp. (strain X514)
B0KCM7 7.85e-72 219 55 3 209 3 rpsD Small ribosomal subunit protein uS4 Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E)
A6Q1K3 1.65e-71 219 53 2 209 3 rpsD Small ribosomal subunit protein uS4 Nitratiruptor sp. (strain SB155-2)
Q0SQH2 2.61e-71 218 55 3 209 3 rpsD1 Small ribosomal subunit protein uS4A Clostridium perfringens (strain SM101 / Type A)
Q8XHV0 2.64e-71 218 55 3 209 3 rpsD1 Small ribosomal subunit protein uS4A Clostridium perfringens (strain 13 / Type A)
Q0TMS4 2.64e-71 218 55 3 209 3 rpsD1 Small ribosomal subunit protein uS4A Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
A9B436 3.7e-71 218 57 4 212 3 rpsD Small ribosomal subunit protein uS4 Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785 / 114-95)
B9MKF4 3.95e-71 218 53 2 209 3 rpsD Small ribosomal subunit protein uS4 Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / KCTC 15123 / Z-1320)
B8DNK8 4.6e-71 218 53 2 209 3 rpsD Small ribosomal subunit protein uS4 Nitratidesulfovibrio vulgaris (strain DSM 19637 / Miyazaki F)
A1VE91 1e-70 217 53 2 209 3 rpsD Small ribosomal subunit protein uS4 Nitratidesulfovibrio vulgaris (strain DP4)
Q72CF5 1e-70 217 53 2 209 3 rpsD Small ribosomal subunit protein uS4 Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
Q7M8F6 1.15e-70 216 53 2 209 3 rpsD Small ribosomal subunit protein uS4 Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
A1ALW6 2.17e-70 216 52 2 209 3 rpsD Small ribosomal subunit protein uS4 Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
A0LIL6 2.79e-70 216 50 2 209 3 rpsD Small ribosomal subunit protein uS4 Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)
Q3A6M1 3.43e-70 215 52 3 210 3 rpsD Small ribosomal subunit protein uS4 Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
A3DJK0 4.27e-70 215 53 2 209 3 rpsD Small ribosomal subunit protein uS4 Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
C5CGH5 8.31e-70 214 50 2 209 3 rpsD Small ribosomal subunit protein uS4 Kosmotoga olearia (strain ATCC BAA-1733 / DSM 21960 / TBF 19.5.1)
C6C1B0 1.45e-69 214 54 2 209 3 rpsD Small ribosomal subunit protein uS4 Maridesulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIMB 8403 / VKM B-1763)
Q67JX0 1.89e-69 213 54 3 209 3 rpsD1 Small ribosomal subunit protein uS4A Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
B5EM98 2.48e-69 213 54 2 209 3 rpsD Small ribosomal subunit protein uS4 Acidithiobacillus ferrooxidans (strain ATCC 53993 / BNL-5-31)
B7J4A3 2.48e-69 213 54 2 209 3 rpsD Small ribosomal subunit protein uS4 Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)
Q890Q9 2.68e-69 213 52 3 209 3 rpsD Small ribosomal subunit protein uS4 Clostridium tetani (strain Massachusetts / E88)
B8D0T6 3.36e-69 213 50 2 209 3 rpsD Small ribosomal subunit protein uS4 Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562)
Q1MPP2 5.44e-69 212 52 2 209 3 rpsD Small ribosomal subunit protein uS4 Lawsonia intracellularis (strain PHE/MN1-00)
A8MLG8 6.91e-69 212 53 3 209 3 rpsD1 Small ribosomal subunit protein uS4A Alkaliphilus oremlandii (strain OhILAs)
A6QCS3 3.08e-68 210 52 2 209 3 rpsD Small ribosomal subunit protein uS4 Sulfurovum sp. (strain NBC37-1)
A8ETK5 3.26e-68 210 51 2 209 3 rpsD Small ribosomal subunit protein uS4 Aliarcobacter butzleri (strain RM4018)
P80373 3.71e-68 210 51 4 212 1 rpsD Small ribosomal subunit protein uS4 Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
P62664 3.71e-68 210 51 4 212 1 rpsD Small ribosomal subunit protein uS4 Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27)
B0TC84 3.71e-68 210 50 2 209 3 rpsD Small ribosomal subunit protein uS4 Heliobacterium modesticaldum (strain ATCC 51547 / Ice1)
Q30Z67 1.57e-67 208 51 2 209 3 rpsD Small ribosomal subunit protein uS4 Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
Q1D749 1.75e-67 208 52 2 209 3 rpsD1 Small ribosomal subunit protein uS4A Myxococcus xanthus (strain DK1622)
A5D5E8 2.37e-67 208 54 2 209 3 rpsD Small ribosomal subunit protein uS4 Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI)
C4XLK2 3.19e-67 207 51 2 209 3 rpsD Small ribosomal subunit protein uS4 Solidesulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1)
Q9X1I3 3.96e-67 207 51 4 212 3 rpsD Small ribosomal subunit protein uS4 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
A6LLP0 4.09e-67 207 51 4 212 3 rpsD Small ribosomal subunit protein uS4 Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429)
B9K8B3 4.18e-67 207 50 4 212 3 rpsD Small ribosomal subunit protein uS4 Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NBRC 107923 / NS-E)
A4J138 4.72e-67 207 54 2 209 3 rpsD Small ribosomal subunit protein uS4 Desulforamulus reducens (strain ATCC BAA-1160 / DSM 100696 / MI-1)
C0Q9U8 5.15e-67 207 51 2 209 3 rpsD Small ribosomal subunit protein uS4 Desulforapulum autotrophicum (strain ATCC 43914 / DSM 3382 / VKM B-1955 / HRM2)
B8I807 5.21e-67 207 51 2 209 3 rpsD Small ribosomal subunit protein uS4 Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10)
Q7VGC0 6.41e-67 207 51 2 209 3 rpsD Small ribosomal subunit protein uS4 Helicobacter hepaticus (strain ATCC 51449 / 3B1)
B8IYL6 8.42e-67 207 51 2 209 3 rpsD Small ribosomal subunit protein uS4 Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949 / MB)
B1LBL3 1.26e-66 206 50 4 212 3 rpsD Small ribosomal subunit protein uS4 Thermotoga sp. (strain RQ2)
A5IMB0 1.26e-66 206 50 4 212 3 rpsD Small ribosomal subunit protein uS4 Thermotoga petrophila (strain ATCC BAA-488 / DSM 13995 / JCM 10881 / RKU-1)
B8FER0 1.5e-66 206 51 2 209 3 rpsD Small ribosomal subunit protein uS4 Desulfatibacillum aliphaticivorans
B3QYE9 2.54e-66 205 51 3 211 3 rpsD Small ribosomal subunit protein uS4 Chloroherpeton thalassium (strain ATCC 35110 / GB-78)
Q3A9U3 3.26e-66 205 51 2 209 3 rpsD Small ribosomal subunit protein uS4 Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
A6TWF4 4.57e-66 205 52 4 211 3 rpsD1 Small ribosomal subunit protein uS4A Alkaliphilus metalliredigens (strain QYMF)
A0LRP7 5.87e-66 204 51 2 209 3 rpsD Small ribosomal subunit protein uS4 Acidothermus cellulolyticus (strain ATCC 43068 / DSM 8971 / 11B)
A6LEG6 8.1e-66 204 52 3 207 3 rpsD Small ribosomal subunit protein uS4 Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)
Q30TS4 1.33e-65 204 51 2 209 3 rpsD Small ribosomal subunit protein uS4 Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251)
B4UBC5 2.01e-65 203 51 2 209 3 rpsD Small ribosomal subunit protein uS4 Anaeromyxobacter sp. (strain K)
Q2IJ65 2.01e-65 203 51 2 209 3 rpsD Small ribosomal subunit protein uS4 Anaeromyxobacter dehalogenans (strain 2CP-C)
B8J886 2.01e-65 203 51 2 209 3 rpsD Small ribosomal subunit protein uS4 Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258)
B7IHX2 3.4e-65 202 50 4 212 3 rpsD Small ribosomal subunit protein uS4 Thermosipho africanus (strain TCF52B)
Q18CI6 6.69e-65 202 51 3 209 3 rpsD Small ribosomal subunit protein uS4 Clostridioides difficile (strain 630)
Q01WB9 6.97e-65 202 51 4 211 3 rpsD Small ribosomal subunit protein uS4 Solibacter usitatus (strain Ellin6076)
Q6AP44 9.15e-65 201 51 3 210 3 rpsD Small ribosomal subunit protein uS4 Desulfotalea psychrophila (strain LSv54 / DSM 12343)
B8E1F9 1.07e-64 201 48 3 209 3 rpsD Small ribosomal subunit protein uS4 Dictyoglomus turgidum (strain DSM 6724 / Z-1310)
B3EGW4 1.32e-64 201 49 3 210 3 rpsD Small ribosomal subunit protein uS4 Chlorobium limicola (strain DSM 245 / NBRC 103803 / 6330)
B5YDW9 3.05e-64 200 48 3 209 3 rpsD Small ribosomal subunit protein uS4 Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12)
A0RM35 3.66e-64 200 52 2 209 3 rpsD Small ribosomal subunit protein uS4 Campylobacter fetus subsp. fetus (strain 82-40)
Q2LQD0 3.7e-64 200 50 3 210 3 rpsD Small ribosomal subunit protein uS4 Syntrophus aciditrophicus (strain SB)
C1F615 4.17e-64 200 49 3 210 3 rpsD Small ribosomal subunit protein uS4 Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / BCRC 80197 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161)
C5D699 5.41e-64 199 51 5 210 3 rpsD Small ribosomal subunit protein uS4 Geobacillus sp. (strain WCH70)
A7ZFY8 5.43e-64 199 52 2 209 3 rpsD Small ribosomal subunit protein uS4 Campylobacter concisus (strain 13826)
A7HBP4 1.36e-63 198 51 2 209 3 rpsD Small ribosomal subunit protein uS4 Anaeromyxobacter sp. (strain Fw109-5)
A8ZV81 2.47e-63 198 48 2 209 3 rpsD Small ribosomal subunit protein uS4 Desulfosudis oleivorans (strain DSM 6200 / JCM 39069 / Hxd3)
A7HM25 4.35e-63 197 49 3 210 3 rpsD Small ribosomal subunit protein uS4 Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1)
Q3B6D7 4.48e-63 197 49 3 210 3 rpsD Small ribosomal subunit protein uS4 Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530)
P56011 4.5e-63 197 48 2 209 3 rpsD Small ribosomal subunit protein uS4 Helicobacter pylori (strain ATCC 700392 / 26695)
A7H0Z0 5.42e-63 197 51 2 209 3 rpsD Small ribosomal subunit protein uS4 Campylobacter curvus (strain 525.92)
Q3APJ9 8.52e-63 196 49 3 210 3 rpsD Small ribosomal subunit protein uS4 Chlorobium chlorochromatii (strain CaD3)
Q64NN4 8.63e-63 196 51 3 207 3 rpsD Small ribosomal subunit protein uS4 Bacteroides fragilis (strain YCH46)
Q5L8D5 8.63e-63 196 51 3 207 3 rpsD Small ribosomal subunit protein uS4 Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
B1I1B2 1.05e-62 196 51 2 209 3 rpsD Small ribosomal subunit protein uS4 Desulforudis audaxviator (strain MP104C)
Q8A4A1 1.07e-62 196 52 3 207 3 rpsD Small ribosomal subunit protein uS4 Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
Q65G42 1.61e-62 196 50 5 210 3 rpsD Small ribosomal subunit protein uS4 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
A7HZX2 1.92e-62 196 50 2 209 3 rpsD Small ribosomal subunit protein uS4 Campylobacter hominis (strain ATCC BAA-381 / DSM 21671 / CCUG 45161 / LMG 19568 / NCTC 13146 / CH001A)
Q5HSJ7 3.53e-62 195 51 2 209 3 rpsD Small ribosomal subunit protein uS4 Campylobacter jejuni (strain RM1221)
B2UV57 3.65e-62 195 48 2 209 3 rpsD Small ribosomal subunit protein uS4 Helicobacter pylori (strain Shi470)
B5Z8U3 3.65e-62 195 48 2 209 3 rpsD Small ribosomal subunit protein uS4 Helicobacter pylori (strain G27)
B6JND4 3.65e-62 195 48 2 209 3 rpsD Small ribosomal subunit protein uS4 Helicobacter pylori (strain P12)
Q17ZB5 3.65e-62 195 48 2 209 3 rpsD Small ribosomal subunit protein uS4 Helicobacter acinonychis (strain Sheeba)
Q0AUK8 3.81e-62 195 48 3 210 3 rpsD Small ribosomal subunit protein uS4 Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
Q9ZJT4 3.86e-62 195 48 2 209 3 rpsD Small ribosomal subunit protein uS4 Helicobacter pylori (strain J99 / ATCC 700824)
Q6A6R0 3.89e-62 194 51 2 209 1 rpsD Small ribosomal subunit protein uS4 Cutibacterium acnes (strain DSM 16379 / KPA171202)
B9KZW1 4.79e-62 195 46 5 219 3 rpsD Small ribosomal subunit protein uS4 Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2)
Q1IS94 5.28e-62 194 50 3 210 3 rpsD Small ribosomal subunit protein uS4 Koribacter versatilis (strain Ellin345)
A4SCT5 7.46e-62 194 48 2 207 3 rpsD Small ribosomal subunit protein uS4 Chlorobium phaeovibrioides (strain DSM 265 / 1930)
A1W1J6 7.58e-62 194 50 2 209 3 rpsD Small ribosomal subunit protein uS4 Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
A7H5U4 7.58e-62 194 50 2 209 3 rpsD Small ribosomal subunit protein uS4 Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97)
A8FNQ6 7.58e-62 194 50 2 209 3 rpsD Small ribosomal subunit protein uS4 Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
Q1CRW6 9.85e-62 194 48 2 209 3 rpsD Small ribosomal subunit protein uS4 Helicobacter pylori (strain HPAG1)
Q9PM81 9.85e-62 194 50 2 209 3 rpsD Small ribosomal subunit protein uS4 Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
B9LJF8 1.35e-61 193 50 4 210 3 rpsD Small ribosomal subunit protein uS4 Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl)
A9WH92 1.35e-61 193 50 4 210 3 rpsD Small ribosomal subunit protein uS4 Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl)
A7Z7P1 1.42e-61 193 50 5 210 3 rpsD Small ribosomal subunit protein uS4 Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
B9KEH5 1.49e-61 193 51 2 209 3 rpsD Small ribosomal subunit protein uS4 Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060)
P81288 1.91e-61 193 50 5 210 1 rpsD Small ribosomal subunit protein uS4 Geobacillus stearothermophilus
Q9XD10 2.33e-61 193 48 1 207 3 rpsD Small ribosomal subunit protein uS4 Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q72NI7 2.33e-61 193 48 1 207 3 rpsD Small ribosomal subunit protein uS4 Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
A9BFZ1 2.59e-61 193 48 4 212 3 rpsD Small ribosomal subunit protein uS4 Petrotoga mobilis (strain DSM 10674 / SJ95)
Q7NFF4 3.03e-61 192 47 3 209 3 rpsD Small ribosomal subunit protein uS4 Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
B8G1Z3 3.09e-61 192 52 4 210 3 rpsD Small ribosomal subunit protein uS4 Desulfitobacterium hafniense (strain DSM 10664 / DCB-2)
Q055B8 3.13e-61 192 47 1 207 3 rpsD1 Small ribosomal subunit protein uS4 Leptospira borgpetersenii serovar Hardjo-bovis (strain L550)
Q04PW4 3.13e-61 192 47 1 207 3 rpsD Small ribosomal subunit protein uS4 Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197)
B4S5A2 3.43e-61 192 47 3 210 3 rpsD Small ribosomal subunit protein uS4 Prosthecochloris aestuarii (strain DSM 271 / SK 413)
Q250K5 4.24e-61 192 52 4 210 3 rpsD Small ribosomal subunit protein uS4 Desulfitobacterium hafniense (strain Y51)
A8F4T8 9.09e-61 191 46 4 212 3 rpsD Small ribosomal subunit protein uS4 Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO)
Q5KW49 9.49e-61 191 50 5 210 3 rpsD Small ribosomal subunit protein uS4 Geobacillus kaustophilus (strain HTA426)
B0SSF3 1e-60 191 48 2 210 3 rpsD Small ribosomal subunit protein uS4 Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris)
B0SA21 1e-60 191 48 2 210 3 rpsD Small ribosomal subunit protein uS4 Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames)
A4IRU5 1.07e-60 191 49 5 210 3 rpsD Small ribosomal subunit protein uS4 Geobacillus thermodenitrificans (strain NG80-2)
P21466 2.45e-60 190 50 5 210 1 rpsD Small ribosomal subunit protein uS4 Bacillus subtilis (strain 168)
B8DHE5 3.02e-60 190 49 5 210 3 rpsD Small ribosomal subunit protein uS4 Listeria monocytogenes serotype 4a (strain HCC23)
Q8Y6T6 3.22e-60 189 49 5 210 1 rpsD Small ribosomal subunit protein uS4 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
B4SBX3 3.66e-60 189 46 3 210 3 rpsD Small ribosomal subunit protein uS4 Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1)
C0ZHK9 4.28e-60 189 47 3 207 3 rpsD Small ribosomal subunit protein uS4 Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)
Q7MTN9 4.66e-60 189 49 3 207 3 rpsD Small ribosomal subunit protein uS4 Porphyromonas gingivalis (strain ATCC BAA-308 / W83)
B2RLW6 4.66e-60 189 49 3 207 3 rpsD Small ribosomal subunit protein uS4 Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / CIP 103683 / JCM 12257 / NCTC 11834 / 2561)
Q2S3P0 6.54e-60 189 49 4 207 3 rpsD Small ribosomal subunit protein uS4 Salinibacter ruber (strain DSM 13855 / M31)
Q67T95 1.05e-59 188 48 3 207 3 rpsD2 Small ribosomal subunit protein uS4B Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
C1KVP3 1.72e-59 188 49 5 210 3 rpsD Small ribosomal subunit protein uS4 Listeria monocytogenes serotype 4b (strain CLIP80459)
Q92BB2 1.72e-59 188 49 5 210 1 rpsD Small ribosomal subunit protein uS4 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
A0AJ45 1.92e-59 187 49 5 210 3 rpsD Small ribosomal subunit protein uS4 Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
A7GTT6 1.94e-59 187 50 5 210 3 rpsD Small ribosomal subunit protein uS4 Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
C4Z2V6 2.18e-59 187 57 0 160 3 rpsD Small ribosomal subunit protein uS4 Lachnospira eligens (strain ATCC 27750 / DSM 3376 / VPI C15-48 / C15-B4)
Q97EK5 2.95e-59 187 51 3 209 3 rspD1 Small ribosomal subunit protein uS4A Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
B9E7C9 4.17e-59 187 50 5 210 3 rpsD Small ribosomal subunit protein uS4 Macrococcus caseolyticus (strain JCSC5402)
B1MWZ8 4.53e-59 187 49 6 211 3 rpsD Small ribosomal subunit protein uS4 Leuconostoc citreum (strain KM20)
B1HX43 4.6e-59 187 49 5 208 3 rpsD Small ribosomal subunit protein uS4 Lysinibacillus sphaericus (strain C3-41)
Q9K7Z8 4.75e-59 187 49 5 210 3 rpsD Small ribosomal subunit protein uS4 Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
A8FGA1 4.96e-59 187 47 5 210 3 rpsD Small ribosomal subunit protein uS4 Bacillus pumilus (strain SAFR-032)
A1BJ08 5.95e-59 186 46 3 210 3 rpsD Small ribosomal subunit protein uS4 Chlorobium phaeobacteroides (strain DSM 266 / SMG 266 / 2430)
A6KYH1 8.64e-59 186 49 3 207 3 rpsD Small ribosomal subunit protein uS4 Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154)
B7IKS0 9.65e-59 186 50 5 210 3 rpsD Small ribosomal subunit protein uS4 Bacillus cereus (strain G9842)
C4ZBU5 9.69e-59 186 54 0 160 3 rpsD Small ribosomal subunit protein uS4 Agathobacter rectalis (strain ATCC 33656 / DSM 3377 / JCM 17463 / KCTC 5835 / VPI 0990)
C0QQQ0 1.05e-58 186 47 4 209 3 rpsD Small ribosomal subunit protein uS4 Persephonella marina (strain DSM 14350 / EX-H1)
P59129 1.23e-58 186 47 3 210 3 rpsD Small ribosomal subunit protein uS4 Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
B8G6P9 1.3e-58 186 49 4 210 3 rpsD Small ribosomal subunit protein uS4 Chloroflexus aggregans (strain MD-66 / DSM 9485)
A1SNI9 1.41e-58 186 49 2 206 3 rpsD Small ribosomal subunit protein uS4 Nocardioides sp. (strain ATCC BAA-499 / JS614)
Q71Z71 2.31e-58 185 48 5 210 3 rpsD Small ribosomal subunit protein uS4 Listeria monocytogenes serotype 4b (strain F2365)
Q11QD7 3.37e-58 184 50 4 207 3 rpsD Small ribosomal subunit protein uS4 Cytophaga hutchinsonii (strain ATCC 33406 / DSM 1761 / CIP 103989 / NBRC 15051 / NCIMB 9469 / D465)
A9VKG5 3.45e-58 184 49 5 210 3 rpsD Small ribosomal subunit protein uS4 Bacillus mycoides (strain KBAB4)
A9NHG9 3.86e-58 184 46 4 209 3 rpsD Small ribosomal subunit protein uS4 Acholeplasma laidlawii (strain PG-8A)
Q2JFE9 5.44e-58 184 48 3 210 3 rpsD Small ribosomal subunit protein uS4 Frankia casuarinae (strain DSM 45818 / CECT 9043 / HFP020203 / CcI3)
Q817A4 5.46e-58 184 49 5 210 3 rpsD Small ribosomal subunit protein uS4 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
B7H711 5.46e-58 184 49 5 210 3 rpsD Small ribosomal subunit protein uS4 Bacillus cereus (strain B4264)
B7HSJ2 9.31e-58 183 49 5 210 3 rpsD Small ribosomal subunit protein uS4 Bacillus cereus (strain AH187)
Q6HCM2 9.83e-58 183 49 5 210 3 rpsD Small ribosomal subunit protein uS4 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q633E0 9.83e-58 183 49 5 210 3 rpsD Small ribosomal subunit protein uS4 Bacillus cereus (strain ZK / E33L)
C1EV03 9.83e-58 183 49 5 210 3 rpsD Small ribosomal subunit protein uS4 Bacillus cereus (strain 03BB102)
Q72Z76 9.83e-58 183 49 5 210 3 rpsD Small ribosomal subunit protein uS4 Bacillus cereus (strain ATCC 10987 / NRS 248)
B7JS31 9.83e-58 183 49 5 210 3 rpsD Small ribosomal subunit protein uS4 Bacillus cereus (strain AH820)
Q81KT2 9.83e-58 183 49 5 210 3 rpsD Small ribosomal subunit protein uS4 Bacillus anthracis
A0RJP7 9.83e-58 183 49 5 210 3 rpsD Small ribosomal subunit protein uS4 Bacillus thuringiensis (strain Al Hakam)
C3L9W4 9.83e-58 183 49 5 210 3 rpsD Small ribosomal subunit protein uS4 Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3PBC1 9.83e-58 183 49 5 210 3 rpsD Small ribosomal subunit protein uS4 Bacillus anthracis (strain A0248)
Q88UX0 1.17e-57 183 50 5 208 3 rpsD Small ribosomal subunit protein uS4 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
B3EP35 1.55e-57 183 45 2 207 3 rpsD Small ribosomal subunit protein uS4 Chlorobium phaeobacteroides (strain BS1)
Q0RRP4 1.73e-57 183 48 3 210 3 rpsD Small ribosomal subunit protein uS4 Frankia alni (strain DSM 45986 / CECT 9034 / ACN14a)
B2GAZ1 2.4e-57 182 49 5 208 3 rpsD Small ribosomal subunit protein uS4 Limosilactobacillus fermentum (strain NBRC 3956 / LMG 18251)
B1YKD2 2.48e-57 182 48 3 206 3 rpsD Small ribosomal subunit protein uS4 Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)
Q03V53 3e-57 182 49 6 210 3 rpsD Small ribosomal subunit protein uS4 Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
B3QR97 3.1e-57 182 47 3 210 3 rpsD Small ribosomal subunit protein uS4 Chlorobaculum parvum (strain DSM 263 / NCIMB 8327)
A7NR37 3.33e-57 182 49 5 211 3 rpsD Small ribosomal subunit protein uS4 Roseiflexus castenholzii (strain DSM 13941 / HLO8)
Q38XD6 4.61e-57 182 48 5 208 3 rpsD Small ribosomal subunit protein uS4 Latilactobacillus sakei subsp. sakei (strain 23K)
C1CXD5 7.07e-57 181 47 3 209 3 rpsD Small ribosomal subunit protein uS4 Deinococcus deserti (strain DSM 17065 / CIP 109153 / LMG 22923 / VCD115)
B2G6C0 7.69e-57 181 47 5 208 3 rpsD Small ribosomal subunit protein uS4 Limosilactobacillus reuteri subsp. reuteri (strain JCM 1112)
B9J159 7.79e-57 181 49 5 210 3 rpsD Small ribosomal subunit protein uS4 Bacillus cereus (strain Q1)
A0M574 1.03e-56 181 47 4 210 3 rpsD Small ribosomal subunit protein uS4 Christiangramia forsetii (strain DSM 17595 / CGMCC 1.15422 / KT0803)
Q6MJ35 1.25e-56 181 45 2 201 3 rpsD1 Small ribosomal subunit protein uS4A Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)
B2UNG3 1.79e-56 180 51 3 208 3 rpsD Small ribosomal subunit protein uS4 Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc)
P59130 2.58e-56 180 48 5 208 3 rpsD Small ribosomal subunit protein uS4 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q9RSJ7 2.79e-56 180 47 3 208 3 rpsD Small ribosomal subunit protein uS4 Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
Q1BD09 2.84e-56 180 49 2 206 3 rpsD Small ribosomal subunit protein uS4 Mycobacterium sp. (strain MCS)
A1UBY4 2.84e-56 180 49 2 206 3 rpsD Small ribosomal subunit protein uS4 Mycobacterium sp. (strain KMS)
A3PVL7 2.84e-56 180 49 2 206 3 rpsD Small ribosomal subunit protein uS4 Mycobacterium sp. (strain JLS)
Q032G4 5.1e-56 179 48 5 208 3 rpsD Small ribosomal subunit protein uS4 Lactococcus lactis subsp. cremoris (strain SK11)
A2RI10 5.1e-56 179 48 5 208 1 rpsD Small ribosomal subunit protein uS4 Lactococcus lactis subsp. cremoris (strain MG1363)
A5USG3 5.84e-56 179 48 4 210 3 rpsD Small ribosomal subunit protein uS4 Roseiflexus sp. (strain RS-1)
Q04E66 5.86e-56 179 48 6 209 3 rpsD Small ribosomal subunit protein uS4 Oenococcus oeni (strain ATCC BAA-331 / PSU-1)
A5VIU4 6.43e-56 179 47 5 208 3 rpsD Small ribosomal subunit protein uS4 Limosilactobacillus reuteri (strain DSM 20016)
Q1IX98 8.46e-56 179 47 3 209 3 rpsD Small ribosomal subunit protein uS4 Deinococcus geothermalis (strain DSM 11300 / CIP 105573 / AG-3a)
C4L4A0 8.47e-56 178 48 3 206 3 rpsD Small ribosomal subunit protein uS4 Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b)
A0QSL7 8.72e-56 178 48 2 206 1 rpsD Small ribosomal subunit protein uS4 Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q9CIS2 1.4e-55 178 48 5 208 3 rpsD Small ribosomal subunit protein uS4 Lactococcus lactis subsp. lactis (strain IL1403)
A4FPJ3 3.12e-55 177 47 2 206 3 rpsD Small ribosomal subunit protein uS4 Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338)
C1CNV7 3.28e-55 177 47 5 208 3 rpsD Small ribosomal subunit protein uS4 Streptococcus pneumoniae (strain Taiwan19F-14)
C1CHZ1 3.28e-55 177 47 5 208 3 rpsD Small ribosomal subunit protein uS4 Streptococcus pneumoniae (strain P1031)
C1CBQ4 3.28e-55 177 47 5 208 3 rpsD Small ribosomal subunit protein uS4 Streptococcus pneumoniae (strain JJA)
P66566 3.28e-55 177 47 5 208 3 rpsD Small ribosomal subunit protein uS4 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
B2IRG4 3.28e-55 177 47 5 208 3 rpsD Small ribosomal subunit protein uS4 Streptococcus pneumoniae (strain CGSP14)
P66565 3.28e-55 177 47 5 208 3 rpsD Small ribosomal subunit protein uS4 Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
B8ZJX3 3.28e-55 177 47 5 208 3 rpsD Small ribosomal subunit protein uS4 Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1)
B1I7Y6 3.28e-55 177 47 5 208 3 rpsD Small ribosomal subunit protein uS4 Streptococcus pneumoniae (strain Hungary19A-6)
C1C9Y5 3.28e-55 177 47 5 208 3 rpsD Small ribosomal subunit protein uS4 Streptococcus pneumoniae (strain 70585)
B5E5W8 3.28e-55 177 47 5 208 3 rpsD Small ribosomal subunit protein uS4 Streptococcus pneumoniae serotype 19F (strain G54)
Q04MZ3 3.28e-55 177 47 5 208 3 rpsD Small ribosomal subunit protein uS4 Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
A1T519 3.55e-55 177 47 2 206 3 rpsD Small ribosomal subunit protein uS4 Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
A4TEJ4 3.55e-55 177 47 2 206 3 rpsD Small ribosomal subunit protein uS4 Mycolicibacterium gilvum (strain PYR-GCK)
Q1J462 3.66e-55 177 47 5 208 3 rpsD Small ribosomal subunit protein uS4 Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q1WT66 4.51e-55 177 47 6 211 3 rpsD Small ribosomal subunit protein uS4 Ligilactobacillus salivarius (strain UCC118)
P9WH35 5.31e-55 176 48 2 206 1 rpsD Small ribosomal subunit protein uS4 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WH34 5.31e-55 176 48 2 206 3 rpsD Small ribosomal subunit protein uS4 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5U8D4 5.31e-55 176 48 2 206 3 rpsD Small ribosomal subunit protein uS4 Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
C1AHR6 5.31e-55 176 48 2 206 3 rpsD Small ribosomal subunit protein uS4 Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019)
A1KPE4 5.31e-55 176 48 2 206 3 rpsD Small ribosomal subunit protein uS4 Mycobacterium bovis (strain BCG / Pasteur 1173P2)
P45811 5.31e-55 176 48 2 206 1 rpsD Small ribosomal subunit protein uS4 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS16265
Feature type CDS
Gene rpsD
Product 30S ribosomal protein S4
Location 3594006 - 3594626 (strand: 1)
Length 621 (nucleotides) / 206 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_2408
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00163 Ribosomal protein S4/S9 N-terminal domain
PF01479 S4 domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0522 Translation, ribosomal structure and biogenesis (J) J Ribosomal protein S4 or related protein

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02986 small subunit ribosomal protein S4 Ribosome -

Protein Sequence

MARYLGPKLKLSRREGTDLFLKSGVRAIDTKCKLEQAPGQHGARKPRLSDYGVQLREKQKVRRIYGVLERQFRNYYKEATRLKGNTGENLLTLLEGRLDNVVYRMGFGATRAEARQMVSHKAIMVNGRVVNIASYQVSPNDVVSVREKSKKQSRIKAALELAEQREKPTWLEVDAAKMEGVFKRIPERTDLSADINEHLIVELYSK

Flanking regions ( +/- flanking 50bp)

AACGTCGCGTTTAATAACGGTTTCGTTTTTAGGATAGTTGGAGAAAGAAAATGGCAAGATATTTGGGTCCTAAGCTCAAGCTGAGCCGTCGCGAAGGTACAGATTTATTTCTGAAATCTGGCGTTCGGGCGATTGACACCAAGTGTAAACTGGAACAAGCACCAGGTCAGCACGGCGCACGTAAACCGCGTCTGTCTGATTACGGTGTTCAGTTACGTGAAAAACAAAAAGTACGTCGTATTTACGGTGTTCTAGAGCGTCAATTCCGTAACTACTACAAAGAAGCAACACGTCTGAAAGGCAACACAGGTGAGAACTTACTTACTCTGTTAGAAGGTCGTCTGGATAACGTTGTTTATCGTATGGGCTTTGGCGCAACTCGCGCAGAAGCACGTCAGATGGTTAGCCACAAAGCAATCATGGTAAATGGTCGCGTGGTTAATATTGCTTCTTATCAGGTTTCCCCGAATGACGTAGTCAGCGTTCGTGAAAAATCGAAAAAACAGTCTCGTATTAAGGCTGCTTTAGAGCTGGCTGAACAGCGTGAAAAGCCAACATGGCTGGAAGTTGATGCTGCTAAGATGGAAGGTGTGTTCAAACGTATTCCTGAACGTACTGACTTGTCTGCGGACATTAACGAGCACCTGATCGTCGAGCTTTACTCCAAGTAAGGCTTAGCACCAAAGAGAGGACACAATGCAGGGTTCTGTGACAGAGTTTC