Homologs in group_2375

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_19125 FBDBKF_19125 100.0 Morganella morganii S1 rpsD 30S ribosomal protein S4
NLDBIP_18885 NLDBIP_18885 100.0 Morganella morganii S4 rpsD 30S ribosomal protein S4
LHKJJB_18740 LHKJJB_18740 100.0 Morganella morganii S3 rpsD 30S ribosomal protein S4
HKOGLL_18475 HKOGLL_18475 100.0 Morganella morganii S5 rpsD 30S ribosomal protein S4
F4V73_RS19040 F4V73_RS19040 98.5 Morganella psychrotolerans rpsD 30S ribosomal protein S4
PMI_RS16265 PMI_RS16265 95.6 Proteus mirabilis HI4320 rpsD 30S ribosomal protein S4

Distribution of the homologs in the orthogroup group_2375

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2375

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4F1K8 3.76e-148 412 95 0 206 3 rpsD Small ribosomal subunit protein uS4 Proteus mirabilis (strain HI4320)
Q7MYH4 1.19e-146 409 94 0 206 3 rpsD Small ribosomal subunit protein uS4 Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
C6DFS4 6.84e-145 404 93 0 206 3 rpsD Small ribosomal subunit protein uS4 Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q6CZZ4 6.84e-145 404 93 0 206 3 rpsD Small ribosomal subunit protein uS4 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A7MPF7 1.36e-144 404 93 0 206 3 rpsD Small ribosomal subunit protein uS4 Cronobacter sakazakii (strain ATCC BAA-894)
B2VK72 1.63e-144 403 92 0 206 3 rpsD Small ribosomal subunit protein uS4 Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
Q3YWW3 2.29e-144 403 93 0 206 3 rpsD Small ribosomal subunit protein uS4 Shigella sonnei (strain Ss046)
Q0T006 2.29e-144 403 93 0 206 3 rpsD Small ribosomal subunit protein uS4 Shigella flexneri serotype 5b (strain 8401)
Q32B55 2.29e-144 403 93 0 206 3 rpsD Small ribosomal subunit protein uS4 Shigella dysenteriae serotype 1 (strain Sd197)
Q31VY0 2.29e-144 403 93 0 206 3 rpsD Small ribosomal subunit protein uS4 Shigella boydii serotype 4 (strain Sb227)
B2U2R5 2.29e-144 403 93 0 206 3 rpsD Small ribosomal subunit protein uS4 Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B7LRR3 2.29e-144 403 93 0 206 3 rpsD Small ribosomal subunit protein uS4 Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q1R636 2.29e-144 403 93 0 206 3 rpsD Small ribosomal subunit protein uS4 Escherichia coli (strain UTI89 / UPEC)
B1LHB0 2.29e-144 403 93 0 206 3 rpsD Small ribosomal subunit protein uS4 Escherichia coli (strain SMS-3-5 / SECEC)
B6I210 2.29e-144 403 93 0 206 3 rpsD Small ribosomal subunit protein uS4 Escherichia coli (strain SE11)
B7NDR8 2.29e-144 403 93 0 206 3 rpsD Small ribosomal subunit protein uS4 Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A7V8 2.29e-144 403 93 0 206 1 rpsD Small ribosomal subunit protein uS4 Escherichia coli (strain K12)
B1IQ03 2.29e-144 403 93 0 206 3 rpsD Small ribosomal subunit protein uS4 Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0A7V9 2.29e-144 403 93 0 206 3 rpsD Small ribosomal subunit protein uS4 Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TCG5 2.29e-144 403 93 0 206 3 rpsD Small ribosomal subunit protein uS4 Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AGI7 2.29e-144 403 93 0 206 3 rpsD Small ribosomal subunit protein uS4 Escherichia coli O1:K1 / APEC
A8A5A1 2.29e-144 403 93 0 206 3 rpsD Small ribosomal subunit protein uS4 Escherichia coli O9:H4 (strain HS)
B1X6E8 2.29e-144 403 93 0 206 3 rpsD Small ribosomal subunit protein uS4 Escherichia coli (strain K12 / DH10B)
C4ZUF1 2.29e-144 403 93 0 206 3 rpsD Small ribosomal subunit protein uS4 Escherichia coli (strain K12 / MC4100 / BW2952)
B7M102 2.29e-144 403 93 0 206 3 rpsD Small ribosomal subunit protein uS4 Escherichia coli O8 (strain IAI1)
B7N181 2.29e-144 403 93 0 206 3 rpsD Small ribosomal subunit protein uS4 Escherichia coli O81 (strain ED1a)
B7NLL6 2.29e-144 403 93 0 206 3 rpsD Small ribosomal subunit protein uS4 Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5YT15 2.29e-144 403 93 0 206 3 rpsD Small ribosomal subunit protein uS4 Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A7W0 2.29e-144 403 93 0 206 3 rpsD Small ribosomal subunit protein uS4 Escherichia coli O157:H7
B7LHZ8 2.29e-144 403 93 0 206 3 rpsD Small ribosomal subunit protein uS4 Escherichia coli (strain 55989 / EAEC)
B7MCR2 2.29e-144 403 93 0 206 3 rpsD Small ribosomal subunit protein uS4 Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UK20 2.29e-144 403 93 0 206 3 rpsD Small ribosomal subunit protein uS4 Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZSI5 2.29e-144 403 93 0 206 3 rpsD Small ribosomal subunit protein uS4 Escherichia coli O139:H28 (strain E24377A / ETEC)
A8AQJ1 2.29e-144 403 93 0 206 3 rpsD Small ribosomal subunit protein uS4 Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
A8GKH4 2.82e-144 402 92 0 206 3 rpsD Small ribosomal subunit protein uS4 Serratia proteamaculans (strain 568)
C5BF28 3.28e-144 402 92 0 206 3 rpsD Small ribosomal subunit protein uS4 Edwardsiella ictaluri (strain 93-146)
B1JJG9 3.39e-144 402 93 0 206 3 rpsD Small ribosomal subunit protein uS4 Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q664U5 3.39e-144 402 93 0 206 3 rpsD Small ribosomal subunit protein uS4 Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TH14 3.39e-144 402 93 0 206 3 rpsD Small ribosomal subunit protein uS4 Yersinia pestis (strain Pestoides F)
Q1CCW7 3.39e-144 402 93 0 206 3 rpsD Small ribosomal subunit protein uS4 Yersinia pestis bv. Antiqua (strain Nepal516)
A9R917 3.39e-144 402 93 0 206 3 rpsD Small ribosomal subunit protein uS4 Yersinia pestis bv. Antiqua (strain Angola)
Q8ZJ88 3.39e-144 402 93 0 206 3 rpsD Small ribosomal subunit protein uS4 Yersinia pestis
B2K513 3.39e-144 402 93 0 206 3 rpsD Small ribosomal subunit protein uS4 Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C2X0 3.39e-144 402 93 0 206 3 rpsD Small ribosomal subunit protein uS4 Yersinia pestis bv. Antiqua (strain Antiqua)
A7FNL1 3.39e-144 402 93 0 206 3 rpsD Small ribosomal subunit protein uS4 Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A1JS02 3.39e-144 402 93 0 206 3 rpsD Small ribosomal subunit protein uS4 Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
O54297 9.41e-144 401 92 0 206 1 rpsD Small ribosomal subunit protein uS4 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B4TXB9 9.41e-144 401 92 0 206 3 rpsD Small ribosomal subunit protein uS4 Salmonella schwarzengrund (strain CVM19633)
Q5PK09 9.41e-144 401 92 0 206 3 rpsD Small ribosomal subunit protein uS4 Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4SUR7 9.41e-144 401 92 0 206 3 rpsD Small ribosomal subunit protein uS4 Salmonella newport (strain SL254)
B4TJY6 9.41e-144 401 92 0 206 3 rpsD Small ribosomal subunit protein uS4 Salmonella heidelberg (strain SL476)
B5RH39 9.41e-144 401 92 0 206 3 rpsD Small ribosomal subunit protein uS4 Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R1F3 9.41e-144 401 92 0 206 3 rpsD Small ribosomal subunit protein uS4 Salmonella enteritidis PT4 (strain P125109)
B5FJJ1 9.41e-144 401 92 0 206 3 rpsD Small ribosomal subunit protein uS4 Salmonella dublin (strain CT_02021853)
Q57J55 9.41e-144 401 92 0 206 3 rpsD Small ribosomal subunit protein uS4 Salmonella choleraesuis (strain SC-B67)
A9MN71 9.41e-144 401 92 0 206 3 rpsD Small ribosomal subunit protein uS4 Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B5F7S2 9.41e-144 401 92 0 206 3 rpsD Small ribosomal subunit protein uS4 Salmonella agona (strain SL483)
Q2NQP6 9.62e-144 401 92 0 206 3 rpsD Small ribosomal subunit protein uS4 Sodalis glossinidius (strain morsitans)
B5BGW2 1.53e-143 401 92 0 206 3 rpsD Small ribosomal subunit protein uS4 Salmonella paratyphi A (strain AKU_12601)
A6TEU9 3.44e-143 400 92 0 206 3 rpsD Small ribosomal subunit protein uS4 Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5XNB5 3.44e-143 400 92 0 206 3 rpsD Small ribosomal subunit protein uS4 Klebsiella pneumoniae (strain 342)
Q8Z1X4 3.63e-143 400 92 0 206 3 rpsD Small ribosomal subunit protein uS4 Salmonella typhi
P59132 4.28e-143 400 92 0 206 3 rpsD Small ribosomal subunit protein uS4 Shigella flexneri
A4WFA4 2.42e-141 395 91 0 206 3 rpsD Small ribosomal subunit protein uS4 Enterobacter sp. (strain 638)
A5UHV4 1.01e-137 386 88 0 206 3 rpsD Small ribosomal subunit protein uS4 Haemophilus influenzae (strain PittGG)
A5UDS3 1.01e-137 386 88 0 206 3 rpsD Small ribosomal subunit protein uS4 Haemophilus influenzae (strain PittEE)
Q4QM98 1.01e-137 386 88 0 206 3 rpsD Small ribosomal subunit protein uS4 Haemophilus influenzae (strain 86-028NP)
B0UX38 1.14e-137 386 88 0 206 3 rpsD Small ribosomal subunit protein uS4 Histophilus somni (strain 2336)
Q0I138 2.63e-137 385 87 0 206 3 rpsD Small ribosomal subunit protein uS4 Histophilus somni (strain 129Pt)
Q9CL53 3.14e-137 385 87 0 206 3 rpsD Small ribosomal subunit protein uS4 Pasteurella multocida (strain Pm70)
Q65QX9 3.78e-137 385 87 0 206 3 rpsD Small ribosomal subunit protein uS4 Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
P44373 5.14e-137 384 87 0 206 3 rpsD Small ribosomal subunit protein uS4 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A6VLL2 1.87e-136 383 87 0 206 3 rpsD Small ribosomal subunit protein uS4 Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
B8F6P7 7.81e-135 379 86 0 206 3 rpsD Small ribosomal subunit protein uS4 Glaesserella parasuis serovar 5 (strain SH0165)
B5FGE0 3.15e-133 375 84 0 206 3 rpsD Small ribosomal subunit protein uS4 Aliivibrio fischeri (strain MJ11)
Q5E890 3.15e-133 375 84 0 206 3 rpsD Small ribosomal subunit protein uS4 Aliivibrio fischeri (strain ATCC 700601 / ES114)
A1S242 9.12e-133 374 85 0 206 3 rpsD Small ribosomal subunit protein uS4 Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
C4L7V4 9.74e-133 374 84 0 206 3 rpsD Small ribosomal subunit protein uS4 Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
A0KF44 1.84e-132 373 84 0 206 3 rpsD Small ribosomal subunit protein uS4 Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
B6EPU8 1.97e-132 373 84 0 206 3 rpsD Small ribosomal subunit protein uS4 Aliivibrio salmonicida (strain LFI1238)
A3Q9A6 2.05e-132 373 84 0 206 3 rpsD Small ribosomal subunit protein uS4 Shewanella loihica (strain ATCC BAA-1088 / PV-4)
Q7MPG5 2.19e-132 372 84 0 206 3 rpsD Small ribosomal subunit protein uS4 Vibrio vulnificus (strain YJ016)
Q8DE62 2.19e-132 372 84 0 206 3 rpsD Small ribosomal subunit protein uS4 Vibrio vulnificus (strain CMCP6)
Q87SZ1 2.27e-132 372 84 0 206 3 rpsD Small ribosomal subunit protein uS4 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
A7N0H7 2.27e-132 372 84 0 206 3 rpsD Small ribosomal subunit protein uS4 Vibrio campbellii (strain ATCC BAA-1116)
A4SSY2 2.79e-132 372 84 0 206 3 rpsD Small ribosomal subunit protein uS4 Aeromonas salmonicida (strain A449)
Q0I081 2.92e-132 372 84 0 206 3 rpsD Small ribosomal subunit protein uS4 Shewanella sp. (strain MR-7)
Q0HNR3 2.92e-132 372 84 0 206 3 rpsD Small ribosomal subunit protein uS4 Shewanella sp. (strain MR-4)
P59131 2.92e-132 372 84 0 206 3 rpsD Small ribosomal subunit protein uS4 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
B7VLD3 3.29e-132 372 84 0 206 3 rpsD Small ribosomal subunit protein uS4 Vibrio atlanticus (strain LGP32)
A0KRP8 4.99e-132 372 84 0 206 3 rpsD Small ribosomal subunit protein uS4 Shewanella sp. (strain ANA-3)
Q7VKF7 1.55e-131 370 85 1 208 3 rpsD Small ribosomal subunit protein uS4 Haemophilus ducreyi (strain 35000HP / ATCC 700724)
B0BSV5 2.28e-131 370 85 1 208 3 rpsD Small ribosomal subunit protein uS4 Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B3GZ35 2.28e-131 370 85 1 208 3 rpsD Small ribosomal subunit protein uS4 Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3N381 2.28e-131 370 85 1 208 3 rpsD Small ribosomal subunit protein uS4 Actinobacillus pleuropneumoniae serotype 5b (strain L20)
Q089N0 2.62e-131 370 84 0 206 3 rpsD Small ribosomal subunit protein uS4 Shewanella frigidimarina (strain NCIMB 400)
A1RED8 3.26e-131 370 83 0 206 3 rpsD Small ribosomal subunit protein uS4 Shewanella sp. (strain W3-18-1)
A4YBV9 3.26e-131 370 83 0 206 3 rpsD Small ribosomal subunit protein uS4 Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
B4RT52 5.82e-131 369 84 0 206 3 rpsD Small ribosomal subunit protein uS4 Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
C3LRN4 8.55e-131 369 83 0 206 3 rpsD Small ribosomal subunit protein uS4 Vibrio cholerae serotype O1 (strain M66-2)
Q9KP07 8.55e-131 369 83 0 206 3 rpsD Small ribosomal subunit protein uS4 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F573 8.55e-131 369 83 0 206 3 rpsD Small ribosomal subunit protein uS4 Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q6LV92 2.48e-130 367 83 0 206 3 rpsD Small ribosomal subunit protein uS4 Photobacterium profundum (strain SS9)
Q12ST5 4.58e-130 367 83 0 206 3 rpsD Small ribosomal subunit protein uS4 Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
A9KWC5 9.34e-130 366 83 0 206 3 rpsD Small ribosomal subunit protein uS4 Shewanella baltica (strain OS195)
A6WHV2 9.34e-130 366 83 0 206 3 rpsD Small ribosomal subunit protein uS4 Shewanella baltica (strain OS185)
A3DA48 9.34e-130 366 83 0 206 3 rpsD Small ribosomal subunit protein uS4 Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8EBI1 9.34e-130 366 83 0 206 3 rpsD Small ribosomal subunit protein uS4 Shewanella baltica (strain OS223)
Q1LTB4 6.65e-129 364 82 0 206 3 rpsD Small ribosomal subunit protein uS4 Baumannia cicadellinicola subsp. Homalodisca coagulata
A8G1C6 1.31e-128 363 83 0 206 3 rpsD Small ribosomal subunit protein uS4 Shewanella sediminis (strain HAW-EB3)
Q15X49 2.06e-128 362 82 0 206 3 rpsD Small ribosomal subunit protein uS4 Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
B1KM36 3.16e-128 362 83 0 206 3 rpsD Small ribosomal subunit protein uS4 Shewanella woodyi (strain ATCC 51908 / MS32)
B8CNF7 8.29e-128 361 81 0 206 3 rpsD Small ribosomal subunit protein uS4 Shewanella piezotolerans (strain WP3 / JCM 13877)
A8GYZ9 8.29e-128 361 81 0 206 3 rpsD Small ribosomal subunit protein uS4 Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
B0TLY9 8.29e-128 361 81 0 206 3 rpsD Small ribosomal subunit protein uS4 Shewanella halifaxensis (strain HAW-EB4)
Q5QXV7 1.67e-127 360 83 0 206 3 rpsD Small ribosomal subunit protein uS4 Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
A1SXW7 5.97e-127 359 82 0 206 3 rpsD1 Small ribosomal subunit protein uS4A Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
A1T0B8 9.25e-127 358 82 0 206 3 rpsD2 Small ribosomal subunit protein uS4B Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
Q3IJJ5 1.45e-126 358 82 0 206 3 rpsD Small ribosomal subunit protein uS4 Pseudoalteromonas translucida (strain TAC 125)
B8D825 8.48e-124 351 78 0 206 3 rpsD Small ribosomal subunit protein uS4 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
P57567 8.48e-124 351 78 0 206 3 rpsD Small ribosomal subunit protein uS4 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B8D9S3 8.48e-124 351 78 0 206 3 rpsD Small ribosomal subunit protein uS4 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
Q9S0Q9 1.09e-123 350 80 0 206 3 rpsD Small ribosomal subunit protein uS4 Shewanella violacea
P41186 8.67e-123 348 78 0 206 3 rpsD Small ribosomal subunit protein uS4 Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
P59491 3.52e-119 339 75 0 206 3 rpsD Small ribosomal subunit protein uS4 Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q2S936 3.02e-118 337 76 0 206 3 rpsD Small ribosomal subunit protein uS4 Hahella chejuensis (strain KCTC 2396)
Q493I5 6.24e-118 336 75 1 207 3 rpsD Small ribosomal subunit protein uS4 Blochmanniella pennsylvanica (strain BPEN)
C4K794 5.28e-117 334 76 0 206 3 rpsD Small ribosomal subunit protein uS4 Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
B8GV34 1.67e-115 330 75 0 206 3 rpsD Small ribosomal subunit protein uS4 Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
A1TYM1 2.15e-114 327 75 0 206 3 rpsD Small ribosomal subunit protein uS4 Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q7NQH6 5.22e-114 326 74 0 206 3 rpsD Small ribosomal subunit protein uS4 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q488Y9 9.72e-112 320 77 0 206 3 rpsD Small ribosomal subunit protein uS4 Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
B3PK61 2.31e-111 320 72 0 206 3 rpsD Small ribosomal subunit protein uS4 Cellvibrio japonicus (strain Ueda107)
Q7VQC4 2.88e-111 319 71 1 207 3 rpsD Small ribosomal subunit protein uS4 Blochmanniella floridana
Q8D1Y9 5.43e-111 318 71 0 206 3 rpsD Small ribosomal subunit protein uS4 Wigglesworthia glossinidia brevipalpis
C5BQ85 1.26e-109 315 72 0 206 3 rpsD Small ribosomal subunit protein uS4 Teredinibacter turnerae (strain ATCC 39867 / T7901)
A1WV98 1.38e-109 315 72 1 207 3 rpsD Small ribosomal subunit protein uS4 Halorhodospira halophila (strain DSM 244 / SL1)
Q31IV9 4.5e-109 313 71 0 206 3 rpsD Small ribosomal subunit protein uS4 Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q3J8T7 7.73e-109 313 70 1 208 3 rpsD Small ribosomal subunit protein uS4 Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
Q21M34 1.15e-108 313 71 0 206 3 rpsD Small ribosomal subunit protein uS4 Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
A6UZL2 1.18e-108 313 71 0 206 3 rpsD Small ribosomal subunit protein uS4 Pseudomonas aeruginosa (strain PA7)
C1DAU2 1.44e-108 312 70 0 206 3 rpsD Small ribosomal subunit protein uS4 Laribacter hongkongensis (strain HLHK9)
Q1R0F1 1.95e-108 312 73 0 206 3 rpsD Small ribosomal subunit protein uS4 Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
C1DKN7 5.01e-108 311 71 0 206 3 rpsD Small ribosomal subunit protein uS4 Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
O52759 8.96e-108 310 71 0 206 1 rpsD Small ribosomal subunit protein uS4 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02T56 8.96e-108 310 71 0 206 3 rpsD Small ribosomal subunit protein uS4 Pseudomonas aeruginosa (strain UCBPP-PA14)
B7V667 8.96e-108 310 71 0 206 3 rpsD Small ribosomal subunit protein uS4 Pseudomonas aeruginosa (strain LESB58)
Q605D6 5.23e-107 308 67 0 206 3 rpsD Small ribosomal subunit protein uS4 Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
A1AVM4 7.53e-107 308 69 1 208 3 rpsD Small ribosomal subunit protein uS4 Ruthia magnifica subsp. Calyptogena magnifica
A1KRJ8 2.08e-106 307 71 0 206 3 rpsD Small ribosomal subunit protein uS4 Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
P66561 2.08e-106 307 71 0 206 3 rpsD Small ribosomal subunit protein uS4 Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
P66560 2.08e-106 307 71 0 206 3 rpsD Small ribosomal subunit protein uS4 Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
A9M3U1 2.08e-106 307 71 0 206 3 rpsD Small ribosomal subunit protein uS4 Neisseria meningitidis serogroup C (strain 053442)
Q5F5V1 2.08e-106 307 71 0 206 3 rpsD Small ribosomal subunit protein uS4 Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
A6W368 3.26e-106 306 69 0 206 3 rpsD Small ribosomal subunit protein uS4 Marinomonas sp. (strain MWYL1)
Q1IFU2 3.3e-106 306 70 0 206 3 rpsD Small ribosomal subunit protein uS4 Pseudomonas entomophila (strain L48)
A4XZ66 4.06e-106 306 70 0 206 3 rpsD Small ribosomal subunit protein uS4 Pseudomonas mendocina (strain ymp)
B0KK90 7.41e-106 305 70 0 206 3 rpsD Small ribosomal subunit protein uS4 Pseudomonas putida (strain GB-1)
Q057C8 7.58e-106 305 66 0 206 3 rpsD Small ribosomal subunit protein uS4 Buchnera aphidicola subsp. Cinara cedri (strain Cc)
Q88QL2 8.45e-106 305 70 0 206 3 rpsD Small ribosomal subunit protein uS4 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
A5VXS1 8.45e-106 305 70 0 206 3 rpsD Small ribosomal subunit protein uS4 Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q0ABF1 1.23e-105 305 70 0 206 3 rpsD Small ribosomal subunit protein uS4 Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
B1JAI8 1.7e-105 305 69 0 206 3 rpsD Small ribosomal subunit protein uS4 Pseudomonas putida (strain W619)
A4G9R4 1.88e-105 305 69 1 207 3 rpsD Small ribosomal subunit protein uS4 Herminiimonas arsenicoxydans
A4VHQ4 2.12e-105 304 69 0 206 3 rpsD Small ribosomal subunit protein uS4 Stutzerimonas stutzeri (strain A1501)
Q4ZMR7 4.01e-105 304 70 0 206 3 rpsD Small ribosomal subunit protein uS4 Pseudomonas syringae pv. syringae (strain B728a)
Q889U7 4.01e-105 304 70 0 206 3 rpsD Small ribosomal subunit protein uS4 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q48D60 4.01e-105 304 70 0 206 3 rpsD Small ribosomal subunit protein uS4 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q3K611 4.67e-105 303 70 0 206 3 rpsD Small ribosomal subunit protein uS4 Pseudomonas fluorescens (strain Pf0-1)
A5CXI8 8.85e-105 303 68 1 208 3 rpsD Small ribosomal subunit protein uS4 Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA)
A6T3H9 9.86e-105 303 70 1 207 3 rpsD Small ribosomal subunit protein uS4 Janthinobacterium sp. (strain Marseille)
A5EX95 1.15e-104 303 69 0 206 3 rpsD Small ribosomal subunit protein uS4 Dichelobacter nodosus (strain VCS1703A)
Q2SU52 1.45e-104 302 71 1 207 3 rpsD Small ribosomal subunit protein uS4 Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
C3K2V2 1.8e-104 302 69 0 206 3 rpsD Small ribosomal subunit protein uS4 Pseudomonas fluorescens (strain SBW25)
A4IZR0 2.17e-104 302 68 0 206 3 rpsD Small ribosomal subunit protein uS4 Francisella tularensis subsp. tularensis (strain WY96-3418)
Q5NHU4 2.82e-104 301 68 0 206 3 rpsD Small ribosomal subunit protein uS4 Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
A0Q4K7 2.82e-104 301 68 0 206 3 rpsD Small ribosomal subunit protein uS4 Francisella tularensis subsp. novicida (strain U112)
Q2A5E6 2.82e-104 301 68 0 206 3 rpsD Small ribosomal subunit protein uS4 Francisella tularensis subsp. holarctica (strain LVS)
A7N9U8 2.82e-104 301 68 0 206 3 rpsD Small ribosomal subunit protein uS4 Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
Q14J96 2.82e-104 301 68 0 206 3 rpsD Small ribosomal subunit protein uS4 Francisella tularensis subsp. tularensis (strain FSC 198)
Q4K556 4.51e-104 301 69 0 206 3 rpsD Small ribosomal subunit protein uS4 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q0VSH9 5.12e-104 301 69 1 210 3 rpsD Small ribosomal subunit protein uS4 Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q0BNQ4 5.49e-104 301 68 0 206 3 rpsD Small ribosomal subunit protein uS4 Francisella tularensis subsp. holarctica (strain OSU18)
B2SDW1 8.8e-104 300 67 0 206 3 rpsD Small ribosomal subunit protein uS4 Francisella tularensis subsp. mediasiatica (strain FSC147)
A4JAR5 3.7e-103 299 70 1 207 3 rpsD Small ribosomal subunit protein uS4 Burkholderia vietnamiensis (strain G4 / LMG 22486)
A9ADL8 4.46e-103 298 70 1 207 3 rpsD Small ribosomal subunit protein uS4 Burkholderia multivorans (strain ATCC 17616 / 249)
B0U0W6 4.81e-103 298 67 0 206 3 rpsD Small ribosomal subunit protein uS4 Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
B1YRQ4 5.14e-103 298 69 1 207 3 rpsD Small ribosomal subunit protein uS4 Burkholderia ambifaria (strain MC40-6)
Q13TJ5 5.87e-103 298 69 1 207 3 rpsD Small ribosomal subunit protein uS4 Paraburkholderia xenovorans (strain LB400)
A3P088 6.54e-103 298 70 1 207 3 rpsD Small ribosomal subunit protein uS4 Burkholderia pseudomallei (strain 1106a)
Q0BJ21 8.24e-103 298 69 1 207 3 rpsD Small ribosomal subunit protein uS4 Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
B3R7E4 8.7e-103 298 69 1 207 3 rpsD Small ribosomal subunit protein uS4 Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
Q63Q36 9.6e-103 298 70 1 207 3 rpsD Small ribosomal subunit protein uS4 Burkholderia pseudomallei (strain K96243)
A3NEF4 9.6e-103 298 70 1 207 3 rpsD Small ribosomal subunit protein uS4 Burkholderia pseudomallei (strain 668)
Q3JMT8 9.6e-103 298 70 1 207 3 rpsD Small ribosomal subunit protein uS4 Burkholderia pseudomallei (strain 1710b)
A1V878 9.6e-103 298 70 1 207 3 rpsD Small ribosomal subunit protein uS4 Burkholderia mallei (strain SAVP1)
Q62GN0 9.6e-103 298 70 1 207 3 rpsD Small ribosomal subunit protein uS4 Burkholderia mallei (strain ATCC 23344)
A2S7K1 9.6e-103 298 70 1 207 3 rpsD Small ribosomal subunit protein uS4 Burkholderia mallei (strain NCTC 10229)
A3MRX9 9.6e-103 298 70 1 207 3 rpsD Small ribosomal subunit protein uS4 Burkholderia mallei (strain NCTC 10247)
Q39KE2 2.84e-102 296 69 1 207 3 rpsD Small ribosomal subunit protein uS4 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q1BRX3 2.9e-102 296 69 1 207 3 rpsD Small ribosomal subunit protein uS4 Burkholderia orbicola (strain AU 1054)
B1JU47 2.9e-102 296 69 1 207 3 rpsD Small ribosomal subunit protein uS4 Burkholderia orbicola (strain MC0-3)
B4E5E5 2.9e-102 296 69 1 207 3 rpsD Small ribosomal subunit protein uS4 Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
A0K3Q0 2.9e-102 296 69 1 207 3 rpsD Small ribosomal subunit protein uS4 Burkholderia cenocepacia (strain HI2424)
Q0K644 4.08e-102 296 68 1 207 3 rpsD Small ribosomal subunit protein uS4 Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
B2T726 4.97e-102 296 69 1 207 3 rpsD Small ribosomal subunit protein uS4 Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
B2JI40 5.02e-102 296 69 1 207 3 rpsD Small ribosomal subunit protein uS4 Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
Q46WG8 9.07e-102 295 68 1 207 3 rpsD Small ribosomal subunit protein uS4 Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q1LI62 2.15e-101 294 67 1 207 3 rpsD Small ribosomal subunit protein uS4 Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
A1TJU1 3.06e-101 294 68 1 207 3 rpsD Small ribosomal subunit protein uS4 Paracidovorax citrulli (strain AAC00-1)
B9MBW1 3.57e-101 294 68 1 207 3 rpsD Small ribosomal subunit protein uS4 Acidovorax ebreus (strain TPSY)
Q8XV37 8.29e-101 293 68 1 207 3 rpsD Small ribosomal subunit protein uS4 Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
B2UEJ4 9.66e-101 293 68 1 207 3 rpsD Small ribosomal subunit protein uS4 Ralstonia pickettii (strain 12J)
A1W332 1.09e-100 293 68 1 207 3 rpsD Small ribosomal subunit protein uS4 Acidovorax sp. (strain JS42)
A4SUY5 1.3e-100 292 68 1 207 3 rpsD Small ribosomal subunit protein uS4 Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)
A1VJ39 4.94e-100 291 67 1 207 3 rpsD Small ribosomal subunit protein uS4 Polaromonas naphthalenivorans (strain CJ2)
Q5GWV8 6.8e-100 290 66 2 208 3 rpsD Small ribosomal subunit protein uS4 Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
B2SQT3 6.8e-100 290 66 2 208 3 rpsD Small ribosomal subunit protein uS4 Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q2P008 6.8e-100 290 66 2 208 3 rpsD Small ribosomal subunit protein uS4 Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q12G78 1.03e-99 290 67 1 207 3 rpsD Small ribosomal subunit protein uS4 Polaromonas sp. (strain JS666 / ATCC BAA-500)
B0V6U6 1.14e-99 290 69 2 208 3 rpsD Small ribosomal subunit protein uS4 Acinetobacter baumannii (strain AYE)
A3M960 1.14e-99 290 69 2 208 3 rpsD Small ribosomal subunit protein uS4 Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
B0VQU2 1.14e-99 290 69 2 208 3 rpsD Small ribosomal subunit protein uS4 Acinetobacter baumannii (strain SDF)
B7IA15 1.14e-99 290 69 2 208 1 rpsD Small ribosomal subunit protein uS4 Acinetobacter baumannii (strain AB0057)
B7GW26 1.14e-99 290 69 2 208 3 rpsD Small ribosomal subunit protein uS4 Acinetobacter baumannii (strain AB307-0294)
Q3BWW0 1.18e-99 290 66 2 208 3 rpsD Small ribosomal subunit protein uS4 Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
P0A0X9 1.18e-99 290 66 2 208 3 rpsD Small ribosomal subunit protein uS4 Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RU59 1.18e-99 290 66 2 208 3 rpsD Small ribosomal subunit protein uS4 Xanthomonas campestris pv. campestris (strain B100)
Q4URG2 1.18e-99 290 66 2 208 3 rpsD Small ribosomal subunit protein uS4 Xanthomonas campestris pv. campestris (strain 8004)
P0A0Y0 1.18e-99 290 66 2 208 3 rpsD Small ribosomal subunit protein uS4 Xanthomonas axonopodis pv. citri (strain 306)
B2HZ84 1.2e-99 290 69 2 208 3 rpsD Small ribosomal subunit protein uS4 Acinetobacter baumannii (strain ACICU)
Q6F7T6 1.6e-99 290 68 1 207 3 rpsD Small ribosomal subunit protein uS4 Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
B2FQK7 2.37e-99 289 66 2 209 3 rpsD Small ribosomal subunit protein uS4 Stenotrophomonas maltophilia (strain K279a)
B4SLH4 2.37e-99 289 66 2 209 3 rpsD Small ribosomal subunit protein uS4 Stenotrophomonas maltophilia (strain R551-3)
Q5X835 2.52e-99 289 64 0 206 3 rpsD Small ribosomal subunit protein uS4 Legionella pneumophila (strain Paris)
C5CQ76 2.82e-99 289 67 1 207 3 rpsD Small ribosomal subunit protein uS4 Variovorax paradoxus (strain S110)
Q5WZI8 4.98e-99 288 64 0 206 3 rpsD Small ribosomal subunit protein uS4 Legionella pneumophila (strain Lens)
Q5ZYL9 4.98e-99 288 64 0 206 3 rpsD Small ribosomal subunit protein uS4 Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
A5IHP2 4.98e-99 288 64 0 206 3 rpsD Small ribosomal subunit protein uS4 Legionella pneumophila (strain Corby)
Q21QP8 5.68e-99 288 66 1 207 3 rpsD Small ribosomal subunit protein uS4 Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
P0A4C5 3.35e-98 286 65 1 207 3 rpsD Small ribosomal subunit protein uS4 Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
P0A4C7 3.35e-98 286 65 1 207 3 rpsD Small ribosomal subunit protein uS4 Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
P0A4C6 3.35e-98 286 65 1 207 3 rpsD Small ribosomal subunit protein uS4 Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
B1XSS6 3.95e-98 286 67 1 207 3 rpsD Small ribosomal subunit protein uS4 Polynucleobacter necessarius subsp. necessarius (strain STIR1)
A9IHR7 7.62e-98 285 65 1 207 3 rpsD Small ribosomal subunit protein uS4 Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
Q83EQ3 2.24e-96 281 64 0 206 3 rpsD Small ribosomal subunit protein uS4 Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9NAZ4 2.24e-96 281 64 0 206 3 rpsD Small ribosomal subunit protein uS4 Coxiella burnetii (strain RSA 331 / Henzerling II)
A9KD07 2.24e-96 281 64 0 206 3 rpsD Small ribosomal subunit protein uS4 Coxiella burnetii (strain Dugway 5J108-111)
B6J239 2.24e-96 281 64 0 206 3 rpsD Small ribosomal subunit protein uS4 Coxiella burnetii (strain CbuG_Q212)
B6J5F6 2.34e-96 281 64 0 206 3 rpsD Small ribosomal subunit protein uS4 Coxiella burnetii (strain CbuK_Q154)
A9BRX4 2.37e-96 281 66 1 207 3 rpsD Small ribosomal subunit protein uS4 Delftia acidovorans (strain DSM 14801 / SPH-1)
A1WK93 3.44e-96 281 66 1 207 3 rpsD Small ribosomal subunit protein uS4 Verminephrobacter eiseniae (strain EF01-2)
A2SLD2 5.63e-96 281 67 1 207 3 rpsD Small ribosomal subunit protein uS4 Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
Q2L242 1.82e-95 279 63 1 207 3 rpsD Small ribosomal subunit protein uS4 Bordetella avium (strain 197N)
Q87E60 3.31e-94 276 63 2 208 3 rpsD Small ribosomal subunit protein uS4 Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2I8J2 3.31e-94 276 63 2 208 3 rpsD Small ribosomal subunit protein uS4 Xylella fastidiosa (strain M23)
B0U5M2 8.22e-94 275 62 2 208 3 rpsD Small ribosomal subunit protein uS4 Xylella fastidiosa (strain M12)
Q9PE53 3.12e-93 274 63 2 208 3 rpsD Small ribosomal subunit protein uS4 Xylella fastidiosa (strain 9a5c)
A5WCL3 1.23e-92 272 66 3 213 3 rpsD Small ribosomal subunit protein uS4 Psychrobacter sp. (strain PRwf-1)
B1Y7N0 1.37e-92 272 66 1 207 3 rpsD Small ribosomal subunit protein uS4 Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)
Q1QDG2 6.88e-92 270 64 3 213 3 rpsD Small ribosomal subunit protein uS4 Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q4FUD2 7.19e-92 270 64 3 213 3 rpsD Small ribosomal subunit protein uS4 Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
Q2YAX3 8.79e-89 262 63 2 209 3 rpsD Small ribosomal subunit protein uS4 Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
A0L5Z7 2.15e-87 259 60 2 209 3 rpsD Small ribosomal subunit protein uS4 Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
A1KB02 1.15e-84 252 62 3 210 3 rpsD Small ribosomal subunit protein uS4 Azoarcus sp. (strain BH72)
Q0AIH2 9.65e-82 244 57 2 209 3 rpsD Small ribosomal subunit protein uS4 Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
Q82X70 3.32e-81 243 57 2 209 3 rpsD1 Small ribosomal subunit protein uS4A Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q3SLM5 1.07e-79 239 59 3 210 3 rpsD Small ribosomal subunit protein uS4 Thiobacillus denitrificans (strain ATCC 25259)
Q5P308 3.18e-78 236 57 3 210 3 rpsD Small ribosomal subunit protein uS4 Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
B5YG23 6.29e-77 232 55 2 209 3 rpsD Small ribosomal subunit protein uS4 Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87)
Q47J78 9.03e-77 232 55 3 210 3 rpsD Small ribosomal subunit protein uS4 Dechloromonas aromatica (strain RCB)
B9L6T8 4.94e-74 225 54 2 209 3 rpsD Small ribosomal subunit protein uS4 Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH)
Q39XY0 6.71e-74 224 53 2 209 3 rpsD Small ribosomal subunit protein uS4 Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
Q749B2 1e-73 224 53 2 209 3 rpsD Small ribosomal subunit protein uS4 Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Q2RFS5 1.51e-73 224 54 2 209 3 rpsD Small ribosomal subunit protein uS4 Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
B3E856 3.27e-73 223 54 2 209 3 rpsD Small ribosomal subunit protein uS4 Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)
A5GAU5 3.94e-73 223 54 2 209 3 rpsD Small ribosomal subunit protein uS4 Geotalea uraniireducens (strain Rf4)
B9M6F3 5.46e-73 222 53 2 209 3 rpsD Small ribosomal subunit protein uS4 Geotalea daltonii (strain DSM 22248 / JCM 15807 / FRC-32)
B2TIK3 9.64e-73 222 53 3 209 3 rpsD Small ribosomal subunit protein uS4 Clostridium botulinum (strain Eklund 17B / Type B)
B2UYD8 9.64e-73 222 53 3 209 3 rpsD Small ribosomal subunit protein uS4 Clostridium botulinum (strain Alaska E43 / Type E3)
C6E4N1 2.24e-72 221 54 2 209 3 rpsD Small ribosomal subunit protein uS4 Geobacter sp. (strain M21)
A6LPT9 3.99e-72 220 53 3 209 3 rpsD Small ribosomal subunit protein uS4 Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
A1VE91 4.35e-72 220 55 2 209 3 rpsD Small ribosomal subunit protein uS4 Nitratidesulfovibrio vulgaris (strain DP4)
Q72CF5 4.35e-72 220 55 2 209 3 rpsD Small ribosomal subunit protein uS4 Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
B5EFS6 6.52e-72 219 53 2 209 3 rpsD Small ribosomal subunit protein uS4 Citrifermentans bemidjiense (strain ATCC BAA-1014 / DSM 16622 / JCM 12645 / Bem)
A0PXX4 7.52e-72 219 54 3 209 3 rpsD1 Small ribosomal subunit protein uS4A Clostridium novyi (strain NT)
A6Q1K3 7.68e-72 219 54 2 209 3 rpsD Small ribosomal subunit protein uS4 Nitratiruptor sp. (strain SB155-2)
B2A4P9 2.03e-71 218 56 3 210 3 rpsD Small ribosomal subunit protein uS4 Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF)
Q8R7Y1 2.42e-71 218 53 3 209 3 rpsD Small ribosomal subunit protein uS4 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
B8DNK8 3.18e-71 218 54 2 209 3 rpsD Small ribosomal subunit protein uS4 Nitratidesulfovibrio vulgaris (strain DSM 19637 / Miyazaki F)
A4XLQ3 4.65e-71 218 53 2 209 3 rpsD Small ribosomal subunit protein uS4 Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331)
B0K5S0 5.73e-71 217 53 3 209 3 rpsD Small ribosomal subunit protein uS4 Thermoanaerobacter sp. (strain X514)
B0KCM7 5.73e-71 217 53 3 209 3 rpsD Small ribosomal subunit protein uS4 Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E)
A7GJ46 1.37e-70 216 53 3 209 3 rpsD1 Small ribosomal subunit protein uS4A Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)
A5I7H8 1.37e-70 216 53 3 209 3 rpsD1 Small ribosomal subunit protein uS4A Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)
A7FZ45 1.37e-70 216 53 3 209 3 rpsD1 Small ribosomal subunit protein uS4A Clostridium botulinum (strain ATCC 19397 / Type A)
C5CGH5 1.58e-70 216 51 2 209 3 rpsD Small ribosomal subunit protein uS4 Kosmotoga olearia (strain ATCC BAA-1733 / DSM 21960 / TBF 19.5.1)
B9MKF4 3.71e-70 215 52 2 209 3 rpsD Small ribosomal subunit protein uS4 Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / KCTC 15123 / Z-1320)
Q8XHV0 3.87e-70 215 53 3 209 3 rpsD1 Small ribosomal subunit protein uS4A Clostridium perfringens (strain 13 / Type A)
Q0TMS4 3.87e-70 215 53 3 209 3 rpsD1 Small ribosomal subunit protein uS4A Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Q0SQH2 4.14e-70 215 53 3 209 3 rpsD1 Small ribosomal subunit protein uS4A Clostridium perfringens (strain SM101 / Type A)
Q7M8F6 5.86e-70 214 52 2 209 3 rpsD Small ribosomal subunit protein uS4 Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
A9B436 5.92e-70 215 55 4 212 3 rpsD Small ribosomal subunit protein uS4 Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785 / 114-95)
A1ALW6 9.37e-70 214 52 2 209 3 rpsD Small ribosomal subunit protein uS4 Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
A3DJK0 2.29e-69 213 52 2 209 3 rpsD Small ribosomal subunit protein uS4 Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
Q1MPP2 4.09e-69 213 52 2 209 3 rpsD Small ribosomal subunit protein uS4 Lawsonia intracellularis (strain PHE/MN1-00)
B8D0T6 4.47e-69 213 49 2 209 3 rpsD Small ribosomal subunit protein uS4 Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562)
Q3A6M1 5.74e-69 212 51 3 210 3 rpsD Small ribosomal subunit protein uS4 Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
A8ETK5 6.99e-69 212 52 2 209 3 rpsD Small ribosomal subunit protein uS4 Aliarcobacter butzleri (strain RM4018)
B5EM98 7.06e-69 212 52 2 209 3 rpsD Small ribosomal subunit protein uS4 Acidithiobacillus ferrooxidans (strain ATCC 53993 / BNL-5-31)
B7J4A3 7.06e-69 212 52 2 209 3 rpsD Small ribosomal subunit protein uS4 Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)
Q67JX0 8.14e-69 212 52 3 209 3 rpsD1 Small ribosomal subunit protein uS4A Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
A0LIL6 8.23e-69 212 48 2 209 3 rpsD Small ribosomal subunit protein uS4 Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)
C6C1B0 1.08e-68 211 53 2 209 3 rpsD Small ribosomal subunit protein uS4 Maridesulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIMB 8403 / VKM B-1763)
A6QCS3 1.19e-68 211 53 2 209 3 rpsD Small ribosomal subunit protein uS4 Sulfurovum sp. (strain NBC37-1)
Q30Z67 2.51e-68 211 53 2 209 3 rpsD Small ribosomal subunit protein uS4 Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
B0TC84 2.53e-68 211 50 2 209 3 rpsD Small ribosomal subunit protein uS4 Heliobacterium modesticaldum (strain ATCC 51547 / Ice1)
A8MLG8 4.52e-68 210 53 3 209 3 rpsD1 Small ribosomal subunit protein uS4A Alkaliphilus oremlandii (strain OhILAs)
Q890Q9 7.72e-68 209 51 3 209 3 rpsD Small ribosomal subunit protein uS4 Clostridium tetani (strain Massachusetts / E88)
Q7VGC0 1.33e-67 209 51 2 209 3 rpsD Small ribosomal subunit protein uS4 Helicobacter hepaticus (strain ATCC 51449 / 3B1)
C4XLK2 1.53e-67 209 52 2 209 3 rpsD Small ribosomal subunit protein uS4 Solidesulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1)
A5D5E8 5.04e-67 207 54 2 209 3 rpsD Small ribosomal subunit protein uS4 Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI)
C0Q9U8 9.28e-67 206 50 2 209 3 rpsD Small ribosomal subunit protein uS4 Desulforapulum autotrophicum (strain ATCC 43914 / DSM 3382 / VKM B-1955 / HRM2)
B8FER0 1.01e-66 206 51 2 209 3 rpsD Small ribosomal subunit protein uS4 Desulfatibacillum aliphaticivorans
Q1D749 1.36e-66 206 50 2 209 3 rpsD1 Small ribosomal subunit protein uS4A Myxococcus xanthus (strain DK1622)
A4J138 1.75e-66 206 53 2 209 3 rpsD Small ribosomal subunit protein uS4 Desulforamulus reducens (strain ATCC BAA-1160 / DSM 100696 / MI-1)
P80373 1.91e-66 206 49 4 212 1 rpsD Small ribosomal subunit protein uS4 Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
P62664 1.91e-66 206 49 4 212 1 rpsD Small ribosomal subunit protein uS4 Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27)
A6LLP0 2.76e-66 205 50 4 212 3 rpsD Small ribosomal subunit protein uS4 Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429)
B9K8B3 3.44e-66 205 49 4 212 3 rpsD Small ribosomal subunit protein uS4 Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NBRC 107923 / NS-E)
Q9X1I3 3.47e-66 205 49 4 212 3 rpsD Small ribosomal subunit protein uS4 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
B8I807 3.55e-66 205 50 2 209 3 rpsD Small ribosomal subunit protein uS4 Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10)
B8IYL6 5.15e-66 204 50 2 209 3 rpsD Small ribosomal subunit protein uS4 Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949 / MB)
B1LBL3 5.74e-66 204 49 4 212 3 rpsD Small ribosomal subunit protein uS4 Thermotoga sp. (strain RQ2)
A5IMB0 5.74e-66 204 49 4 212 3 rpsD Small ribosomal subunit protein uS4 Thermotoga petrophila (strain ATCC BAA-488 / DSM 13995 / JCM 10881 / RKU-1)
Q3A9U3 2.01e-65 203 50 2 209 3 rpsD Small ribosomal subunit protein uS4 Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
B3QYE9 2.25e-65 203 50 3 211 3 rpsD Small ribosomal subunit protein uS4 Chloroherpeton thalassium (strain ATCC 35110 / GB-78)
A6LEG6 2.66e-65 202 51 3 207 3 rpsD Small ribosomal subunit protein uS4 Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)
B7IHX2 3.15e-65 202 50 4 212 3 rpsD Small ribosomal subunit protein uS4 Thermosipho africanus (strain TCF52B)
A0RM35 5.49e-65 202 51 2 209 3 rpsD Small ribosomal subunit protein uS4 Campylobacter fetus subsp. fetus (strain 82-40)
Q30TS4 5.61e-65 202 51 2 209 3 rpsD Small ribosomal subunit protein uS4 Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251)
A6TWF4 6.69e-65 202 50 4 211 3 rpsD1 Small ribosomal subunit protein uS4A Alkaliphilus metalliredigens (strain QYMF)
B4UBC5 6.98e-65 202 50 2 209 3 rpsD Small ribosomal subunit protein uS4 Anaeromyxobacter sp. (strain K)
Q2IJ65 6.98e-65 202 50 2 209 3 rpsD Small ribosomal subunit protein uS4 Anaeromyxobacter dehalogenans (strain 2CP-C)
B8J886 6.98e-65 202 50 2 209 3 rpsD Small ribosomal subunit protein uS4 Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258)
P56011 7.79e-65 202 50 2 209 3 rpsD Small ribosomal subunit protein uS4 Helicobacter pylori (strain ATCC 700392 / 26695)
Q6AP44 1.4e-64 201 51 3 210 3 rpsD Small ribosomal subunit protein uS4 Desulfotalea psychrophila (strain LSv54 / DSM 12343)
Q18CI6 2.3e-64 200 50 3 209 3 rpsD Small ribosomal subunit protein uS4 Clostridioides difficile (strain 630)
A0LRP7 2.7e-64 200 49 2 209 3 rpsD Small ribosomal subunit protein uS4 Acidothermus cellulolyticus (strain ATCC 43068 / DSM 8971 / 11B)
Q01WB9 4.6e-64 200 50 4 211 3 rpsD Small ribosomal subunit protein uS4 Solibacter usitatus (strain Ellin6076)
B3EGW4 5.05e-64 199 48 2 207 3 rpsD Small ribosomal subunit protein uS4 Chlorobium limicola (strain DSM 245 / NBRC 103803 / 6330)
Q2LQD0 5.48e-64 199 50 3 210 3 rpsD Small ribosomal subunit protein uS4 Syntrophus aciditrophicus (strain SB)
B2UV57 5.92e-64 199 50 2 209 3 rpsD Small ribosomal subunit protein uS4 Helicobacter pylori (strain Shi470)
B5Z8U3 5.92e-64 199 50 2 209 3 rpsD Small ribosomal subunit protein uS4 Helicobacter pylori (strain G27)
B6JND4 5.92e-64 199 50 2 209 3 rpsD Small ribosomal subunit protein uS4 Helicobacter pylori (strain P12)
Q17ZB5 5.92e-64 199 50 2 209 3 rpsD Small ribosomal subunit protein uS4 Helicobacter acinonychis (strain Sheeba)
Q9ZJT4 5.99e-64 199 50 2 209 3 rpsD Small ribosomal subunit protein uS4 Helicobacter pylori (strain J99 / ATCC 700824)
C1F615 9.25e-64 199 49 3 210 3 rpsD Small ribosomal subunit protein uS4 Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / BCRC 80197 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161)
A8ZV81 1.09e-63 199 48 2 209 3 rpsD Small ribosomal subunit protein uS4 Desulfosudis oleivorans (strain DSM 6200 / JCM 39069 / Hxd3)
B8E1F9 1.4e-63 198 46 3 209 3 rpsD Small ribosomal subunit protein uS4 Dictyoglomus turgidum (strain DSM 6724 / Z-1310)
A7HM25 1.58e-63 198 50 3 210 3 rpsD Small ribosomal subunit protein uS4 Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1)
C5D699 1.83e-63 198 50 4 207 3 rpsD Small ribosomal subunit protein uS4 Geobacillus sp. (strain WCH70)
Q1CRW6 1.84e-63 198 50 2 209 3 rpsD Small ribosomal subunit protein uS4 Helicobacter pylori (strain HPAG1)
A1W1J6 1.92e-63 198 52 2 209 3 rpsD Small ribosomal subunit protein uS4 Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
A7H5U4 1.92e-63 198 52 2 209 3 rpsD Small ribosomal subunit protein uS4 Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97)
A8FNQ6 1.92e-63 198 52 2 209 3 rpsD Small ribosomal subunit protein uS4 Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
Q5HSJ7 2.82e-63 197 51 2 209 3 rpsD Small ribosomal subunit protein uS4 Campylobacter jejuni (strain RM1221)
Q9PM81 2.82e-63 197 51 2 209 3 rpsD Small ribosomal subunit protein uS4 Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
A7H0Z0 2.88e-63 197 50 2 209 3 rpsD Small ribosomal subunit protein uS4 Campylobacter curvus (strain 525.92)
A7ZFY8 4.04e-63 197 49 2 209 3 rpsD Small ribosomal subunit protein uS4 Campylobacter concisus (strain 13826)
A7HBP4 4.45e-63 197 49 2 209 3 rpsD Small ribosomal subunit protein uS4 Anaeromyxobacter sp. (strain Fw109-5)
A7HZX2 9.45e-63 196 50 2 209 3 rpsD Small ribosomal subunit protein uS4 Campylobacter hominis (strain ATCC BAA-381 / DSM 21671 / CCUG 45161 / LMG 19568 / NCTC 13146 / CH001A)
B1I1B2 1.12e-62 196 51 2 209 3 rpsD Small ribosomal subunit protein uS4 Desulforudis audaxviator (strain MP104C)
B5YDW9 1.88e-62 196 46 3 209 3 rpsD Small ribosomal subunit protein uS4 Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12)
Q65G42 2.14e-62 195 50 5 210 3 rpsD Small ribosomal subunit protein uS4 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q3B6D7 2.83e-62 195 48 2 207 3 rpsD Small ribosomal subunit protein uS4 Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530)
B9KEH5 3.17e-62 195 50 2 209 3 rpsD Small ribosomal subunit protein uS4 Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060)
Q8A4A1 3.34e-62 195 50 3 207 3 rpsD Small ribosomal subunit protein uS4 Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
Q64NN4 4.15e-62 194 49 3 207 3 rpsD Small ribosomal subunit protein uS4 Bacteroides fragilis (strain YCH46)
Q5L8D5 4.15e-62 194 49 3 207 3 rpsD Small ribosomal subunit protein uS4 Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
Q3APJ9 4.23e-62 194 48 2 207 3 rpsD Small ribosomal subunit protein uS4 Chlorobium chlorochromatii (strain CaD3)
A9BFZ1 5.75e-62 194 47 4 212 3 rpsD Small ribosomal subunit protein uS4 Petrotoga mobilis (strain DSM 10674 / SJ95)
A4SCT5 2.06e-61 193 47 2 207 3 rpsD Small ribosomal subunit protein uS4 Chlorobium phaeovibrioides (strain DSM 265 / 1930)
B9KZW1 2.13e-61 193 45 5 219 3 rpsD Small ribosomal subunit protein uS4 Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2)
Q1IS94 2.33e-61 193 49 3 210 3 rpsD Small ribosomal subunit protein uS4 Koribacter versatilis (strain Ellin345)
Q055B8 2.84e-61 192 47 1 207 3 rpsD1 Small ribosomal subunit protein uS4 Leptospira borgpetersenii serovar Hardjo-bovis (strain L550)
Q04PW4 2.84e-61 192 47 1 207 3 rpsD Small ribosomal subunit protein uS4 Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197)
B9LJF8 3.77e-61 192 49 4 210 3 rpsD Small ribosomal subunit protein uS4 Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl)
A9WH92 3.77e-61 192 49 4 210 3 rpsD Small ribosomal subunit protein uS4 Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl)
Q9XD10 7.17e-61 191 47 1 207 3 rpsD Small ribosomal subunit protein uS4 Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q72NI7 7.17e-61 191 47 1 207 3 rpsD Small ribosomal subunit protein uS4 Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
C0ZHK9 7.48e-61 191 48 3 207 3 rpsD Small ribosomal subunit protein uS4 Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)
P81288 7.8e-61 191 49 4 207 1 rpsD Small ribosomal subunit protein uS4 Geobacillus stearothermophilus
Q6A6R0 8.23e-61 191 50 1 206 1 rpsD Small ribosomal subunit protein uS4 Cutibacterium acnes (strain DSM 16379 / KPA171202)
B4S5A2 9.16e-61 191 46 2 207 3 rpsD Small ribosomal subunit protein uS4 Prosthecochloris aestuarii (strain DSM 271 / SK 413)
B0SSF3 9.48e-61 191 48 2 210 3 rpsD Small ribosomal subunit protein uS4 Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris)
B0SA21 9.48e-61 191 48 2 210 3 rpsD Small ribosomal subunit protein uS4 Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames)
Q0AUK8 1e-60 191 46 3 210 3 rpsD Small ribosomal subunit protein uS4 Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
A7Z7P1 1.27e-60 191 48 5 210 3 rpsD Small ribosomal subunit protein uS4 Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
Q5KW49 2.89e-60 190 49 4 207 3 rpsD Small ribosomal subunit protein uS4 Geobacillus kaustophilus (strain HTA426)
Q7NFF4 3.49e-60 190 46 3 209 3 rpsD Small ribosomal subunit protein uS4 Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
A4IRU5 4e-60 189 48 4 207 3 rpsD Small ribosomal subunit protein uS4 Geobacillus thermodenitrificans (strain NG80-2)
B8G1Z3 4.09e-60 190 50 4 210 3 rpsD Small ribosomal subunit protein uS4 Desulfitobacterium hafniense (strain DSM 10664 / DCB-2)
Q250K5 5.09e-60 189 50 4 210 3 rpsD Small ribosomal subunit protein uS4 Desulfitobacterium hafniense (strain Y51)
A8F4T8 7.44e-60 189 44 4 212 3 rpsD Small ribosomal subunit protein uS4 Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO)
Q67T95 1.15e-59 188 47 3 207 3 rpsD2 Small ribosomal subunit protein uS4B Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
Q7MTN9 1.84e-59 188 47 3 207 3 rpsD Small ribosomal subunit protein uS4 Porphyromonas gingivalis (strain ATCC BAA-308 / W83)
B2RLW6 1.84e-59 188 47 3 207 3 rpsD Small ribosomal subunit protein uS4 Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / CIP 103683 / JCM 12257 / NCTC 11834 / 2561)
B4SBX3 1.87e-59 188 45 2 207 3 rpsD Small ribosomal subunit protein uS4 Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1)
C4Z2V6 1.93e-59 187 58 0 160 3 rpsD Small ribosomal subunit protein uS4 Lachnospira eligens (strain ATCC 27750 / DSM 3376 / VPI C15-48 / C15-B4)
P21466 2.34e-59 187 48 5 210 1 rpsD Small ribosomal subunit protein uS4 Bacillus subtilis (strain 168)
B8DHE5 2.64e-59 187 48 5 210 3 rpsD Small ribosomal subunit protein uS4 Listeria monocytogenes serotype 4a (strain HCC23)
Q8Y6T6 2.79e-59 187 48 5 210 1 rpsD Small ribosomal subunit protein uS4 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
C4ZBU5 5.04e-59 186 56 0 160 3 rpsD Small ribosomal subunit protein uS4 Agathobacter rectalis (strain ATCC 33656 / DSM 3377 / JCM 17463 / KCTC 5835 / VPI 0990)
B1HX43 6.74e-59 186 48 5 208 3 rpsD Small ribosomal subunit protein uS4 Lysinibacillus sphaericus (strain C3-41)
C0QQQ0 1.14e-58 186 47 4 209 3 rpsD Small ribosomal subunit protein uS4 Persephonella marina (strain DSM 14350 / EX-H1)
C1KVP3 1.23e-58 186 47 5 210 3 rpsD Small ribosomal subunit protein uS4 Listeria monocytogenes serotype 4b (strain CLIP80459)
Q92BB2 1.23e-58 186 47 5 210 1 rpsD Small ribosomal subunit protein uS4 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
B9E7C9 1.43e-58 186 48 5 210 3 rpsD Small ribosomal subunit protein uS4 Macrococcus caseolyticus (strain JCSC5402)
A0AJ45 1.53e-58 185 47 5 210 3 rpsD Small ribosomal subunit protein uS4 Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
A1BJ08 1.83e-58 185 45 2 207 3 rpsD Small ribosomal subunit protein uS4 Chlorobium phaeobacteroides (strain DSM 266 / SMG 266 / 2430)
A8FGA1 1.94e-58 185 46 5 210 3 rpsD Small ribosomal subunit protein uS4 Bacillus pumilus (strain SAFR-032)
A7GTT6 2.09e-58 185 49 5 210 3 rpsD Small ribosomal subunit protein uS4 Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
Q2S3P0 2.38e-58 185 46 4 207 3 rpsD Small ribosomal subunit protein uS4 Salinibacter ruber (strain DSM 13855 / M31)
P59129 3.15e-58 185 47 2 207 3 rpsD Small ribosomal subunit protein uS4 Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
Q9K7Z8 3.27e-58 184 48 4 207 3 rpsD Small ribosomal subunit protein uS4 Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
A1SNI9 6.27e-58 184 48 2 206 3 rpsD Small ribosomal subunit protein uS4 Nocardioides sp. (strain ATCC BAA-499 / JS614)
B7IKS0 8.08e-58 184 48 5 210 3 rpsD Small ribosomal subunit protein uS4 Bacillus cereus (strain G9842)
A6KYH1 8.8e-58 183 47 3 207 3 rpsD Small ribosomal subunit protein uS4 Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154)
Q97EK5 1.25e-57 183 49 3 209 3 rspD1 Small ribosomal subunit protein uS4A Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
B8G6P9 1.36e-57 183 48 4 210 3 rpsD Small ribosomal subunit protein uS4 Chloroflexus aggregans (strain MD-66 / DSM 9485)
Q2JFE9 1.58e-57 183 48 3 210 3 rpsD Small ribosomal subunit protein uS4 Frankia casuarinae (strain DSM 45818 / CECT 9043 / HFP020203 / CcI3)
B1MWZ8 1.61e-57 183 47 6 211 3 rpsD Small ribosomal subunit protein uS4 Leuconostoc citreum (strain KM20)
Q11QD7 1.77e-57 182 48 4 207 3 rpsD Small ribosomal subunit protein uS4 Cytophaga hutchinsonii (strain ATCC 33406 / DSM 1761 / CIP 103989 / NBRC 15051 / NCIMB 9469 / D465)
Q71Z71 1.81e-57 182 47 5 210 3 rpsD Small ribosomal subunit protein uS4 Listeria monocytogenes serotype 4b (strain F2365)
Q38XD6 2.45e-57 182 49 5 208 3 rpsD Small ribosomal subunit protein uS4 Latilactobacillus sakei subsp. sakei (strain 23K)
A9VKG5 2.89e-57 182 48 5 210 3 rpsD Small ribosomal subunit protein uS4 Bacillus mycoides (strain KBAB4)
P59130 4.28e-57 182 48 4 210 3 rpsD Small ribosomal subunit protein uS4 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
B1YKD2 4.62e-57 182 47 3 206 3 rpsD Small ribosomal subunit protein uS4 Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)
Q0RRP4 4.96e-57 182 47 3 210 3 rpsD Small ribosomal subunit protein uS4 Frankia alni (strain DSM 45986 / CECT 9034 / ACN14a)
B3EP35 5.23e-57 182 44 2 207 3 rpsD Small ribosomal subunit protein uS4 Chlorobium phaeobacteroides (strain BS1)
Q817A4 5.55e-57 181 48 5 210 3 rpsD Small ribosomal subunit protein uS4 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
B7H711 5.55e-57 181 48 5 210 3 rpsD Small ribosomal subunit protein uS4 Bacillus cereus (strain B4264)
B3QR97 6.73e-57 181 46 2 207 3 rpsD Small ribosomal subunit protein uS4 Chlorobaculum parvum (strain DSM 263 / NCIMB 8327)
Q88UX0 8.38e-57 181 48 5 208 3 rpsD Small ribosomal subunit protein uS4 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
B2GAZ1 8.48e-57 181 48 5 208 3 rpsD Small ribosomal subunit protein uS4 Limosilactobacillus fermentum (strain NBRC 3956 / LMG 18251)
B2UNG3 9.32e-57 181 50 3 208 3 rpsD Small ribosomal subunit protein uS4 Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc)
A9NHG9 9.4e-57 181 44 4 209 3 rpsD Small ribosomal subunit protein uS4 Acholeplasma laidlawii (strain PG-8A)
B7HSJ2 1.04e-56 181 48 5 210 3 rpsD Small ribosomal subunit protein uS4 Bacillus cereus (strain AH187)
Q6HCM2 1.16e-56 181 48 5 210 3 rpsD Small ribosomal subunit protein uS4 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q633E0 1.16e-56 181 48 5 210 3 rpsD Small ribosomal subunit protein uS4 Bacillus cereus (strain ZK / E33L)
C1EV03 1.16e-56 181 48 5 210 3 rpsD Small ribosomal subunit protein uS4 Bacillus cereus (strain 03BB102)
Q72Z76 1.16e-56 181 48 5 210 3 rpsD Small ribosomal subunit protein uS4 Bacillus cereus (strain ATCC 10987 / NRS 248)
B7JS31 1.16e-56 181 48 5 210 3 rpsD Small ribosomal subunit protein uS4 Bacillus cereus (strain AH820)
Q81KT2 1.16e-56 181 48 5 210 3 rpsD Small ribosomal subunit protein uS4 Bacillus anthracis
A0RJP7 1.16e-56 181 48 5 210 3 rpsD Small ribosomal subunit protein uS4 Bacillus thuringiensis (strain Al Hakam)
C3L9W4 1.16e-56 181 48 5 210 3 rpsD Small ribosomal subunit protein uS4 Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3PBC1 1.16e-56 181 48 5 210 3 rpsD Small ribosomal subunit protein uS4 Bacillus anthracis (strain A0248)
B2G6C0 1.63e-56 180 46 5 208 3 rpsD Small ribosomal subunit protein uS4 Limosilactobacillus reuteri subsp. reuteri (strain JCM 1112)
C1CXD5 3.7e-56 179 45 3 209 3 rpsD Small ribosomal subunit protein uS4 Deinococcus deserti (strain DSM 17065 / CIP 109153 / LMG 22923 / VCD115)
B9J159 7.75e-56 179 47 5 210 3 rpsD Small ribosomal subunit protein uS4 Bacillus cereus (strain Q1)
A0M574 9.11e-56 178 45 4 210 3 rpsD Small ribosomal subunit protein uS4 Christiangramia forsetii (strain DSM 17595 / CGMCC 1.15422 / KT0803)
A5VIU4 1.13e-55 178 46 5 208 3 rpsD Small ribosomal subunit protein uS4 Limosilactobacillus reuteri (strain DSM 20016)
Q03V53 1.19e-55 178 47 6 210 3 rpsD Small ribosomal subunit protein uS4 Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
Q9RSJ7 1.3e-55 178 45 3 208 3 rpsD Small ribosomal subunit protein uS4 Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
Q6MJ35 1.65e-55 178 44 2 201 3 rpsD1 Small ribosomal subunit protein uS4A Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)
A7NR37 1.68e-55 178 47 5 211 3 rpsD Small ribosomal subunit protein uS4 Roseiflexus castenholzii (strain DSM 13941 / HLO8)
Q1BD09 1.71e-55 177 48 2 206 3 rpsD Small ribosomal subunit protein uS4 Mycobacterium sp. (strain MCS)
A1UBY4 1.71e-55 177 48 2 206 3 rpsD Small ribosomal subunit protein uS4 Mycobacterium sp. (strain KMS)
A3PVL7 1.71e-55 177 48 2 206 3 rpsD Small ribosomal subunit protein uS4 Mycobacterium sp. (strain JLS)
C4L4A0 1.81e-55 177 47 3 206 3 rpsD Small ribosomal subunit protein uS4 Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b)
A9KJG7 3.1e-55 177 51 3 207 3 rpsD Small ribosomal subunit protein uS4 Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg)
Q5WEB9 3.23e-55 177 46 4 207 3 rpsD Small ribosomal subunit protein uS4 Shouchella clausii (strain KSM-K16)
A0QSL7 3.59e-55 177 47 2 206 1 rpsD Small ribosomal subunit protein uS4 Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q1IX98 3.92e-55 177 45 3 209 3 rpsD Small ribosomal subunit protein uS4 Deinococcus geothermalis (strain DSM 11300 / CIP 105573 / AG-3a)
Q032G4 5.53e-55 176 46 5 208 3 rpsD Small ribosomal subunit protein uS4 Lactococcus lactis subsp. cremoris (strain SK11)
A2RI10 5.53e-55 176 46 5 208 1 rpsD Small ribosomal subunit protein uS4 Lactococcus lactis subsp. cremoris (strain MG1363)
Q04E66 8.72e-55 176 47 6 209 3 rpsD Small ribosomal subunit protein uS4 Oenococcus oeni (strain ATCC BAA-331 / PSU-1)
Q6KIM1 9.29e-55 176 46 4 206 3 rpsD Small ribosomal subunit protein uS4 Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711)
Q9CIS2 1.01e-54 176 46 5 208 3 rpsD Small ribosomal subunit protein uS4 Lactococcus lactis subsp. lactis (strain IL1403)
O66484 1.3e-54 176 46 4 212 3 rpsD Small ribosomal subunit protein uS4 Aquifex aeolicus (strain VF5)
A4FPJ3 1.33e-54 175 46 2 206 3 rpsD Small ribosomal subunit protein uS4 Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338)
C1CNV7 1.47e-54 175 46 5 208 3 rpsD Small ribosomal subunit protein uS4 Streptococcus pneumoniae (strain Taiwan19F-14)
C1CHZ1 1.47e-54 175 46 5 208 3 rpsD Small ribosomal subunit protein uS4 Streptococcus pneumoniae (strain P1031)
C1CBQ4 1.47e-54 175 46 5 208 3 rpsD Small ribosomal subunit protein uS4 Streptococcus pneumoniae (strain JJA)
P66566 1.47e-54 175 46 5 208 3 rpsD Small ribosomal subunit protein uS4 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
B2IRG4 1.47e-54 175 46 5 208 3 rpsD Small ribosomal subunit protein uS4 Streptococcus pneumoniae (strain CGSP14)
P66565 1.47e-54 175 46 5 208 3 rpsD Small ribosomal subunit protein uS4 Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
B8ZJX3 1.47e-54 175 46 5 208 3 rpsD Small ribosomal subunit protein uS4 Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1)
B1I7Y6 1.47e-54 175 46 5 208 3 rpsD Small ribosomal subunit protein uS4 Streptococcus pneumoniae (strain Hungary19A-6)
C1C9Y5 1.47e-54 175 46 5 208 3 rpsD Small ribosomal subunit protein uS4 Streptococcus pneumoniae (strain 70585)
B5E5W8 1.47e-54 175 46 5 208 3 rpsD Small ribosomal subunit protein uS4 Streptococcus pneumoniae serotype 19F (strain G54)
Q04MZ3 1.47e-54 175 46 5 208 3 rpsD Small ribosomal subunit protein uS4 Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
A5USG3 1.51e-54 176 46 4 210 3 rpsD Small ribosomal subunit protein uS4 Roseiflexus sp. (strain RS-1)
Q1J462 1.57e-54 175 46 5 208 3 rpsD Small ribosomal subunit protein uS4 Streptococcus pyogenes serotype M4 (strain MGAS10750)
A1T519 1.68e-54 175 46 2 206 3 rpsD Small ribosomal subunit protein uS4 Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
A4TEJ4 1.68e-54 175 46 2 206 3 rpsD Small ribosomal subunit protein uS4 Mycolicibacterium gilvum (strain PYR-GCK)
P9WH35 1.9e-54 175 47 2 206 1 rpsD Small ribosomal subunit protein uS4 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WH34 1.9e-54 175 47 2 206 3 rpsD Small ribosomal subunit protein uS4 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5U8D4 1.9e-54 175 47 2 206 3 rpsD Small ribosomal subunit protein uS4 Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_18870
Feature type CDS
Gene rpsD
Product 30S ribosomal protein S4
Location 11191 - 11811 (strand: -1)
Length 621 (nucleotides) / 206 (amino acids)

Contig

Accession ZDB_240
Length 24827 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2375
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00163 Ribosomal protein S4/S9 N-terminal domain
PF01479 S4 domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0522 Translation, ribosomal structure and biogenesis (J) J Ribosomal protein S4 or related protein

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02986 small subunit ribosomal protein S4 Ribosome -

Protein Sequence

MARYLGPKLKLSRREGTDLFLKSGVRAIDTKCKLDQAPGQHGARKPRLSDYGVQLREKQKVRRMYGVLERQFRNYYKEATRLKGNTGENLLSLLEGRLDNVIYRMGFGATRAEARQIVSHKAVMVNGRVVNIASYQVSPNDVISIREKAKKQSRIKAALELAEQREKPTWLEVDAAKMEGVFKRIPERTDLSADINEHLIVELYSK

Flanking regions ( +/- flanking 50bp)

ACGTCGCGTCTAATCGCCCTCACGTTTTTTAGGATAGCTGGAGAAAGAAAATGGCTAGATATTTGGGTCCGAAGCTCAAGCTGAGCCGTCGCGAAGGAACAGACCTCTTCCTGAAGTCTGGTGTTCGCGCGATTGACACCAAGTGTAAATTAGATCAAGCACCAGGCCAGCACGGCGCCCGTAAACCGCGTCTGTCTGATTATGGTGTTCAGTTACGTGAAAAACAAAAAGTTCGTCGTATGTACGGTGTGCTGGAACGTCAGTTCCGTAACTACTATAAAGAAGCAACTCGTCTGAAAGGCAACACAGGTGAAAACCTGCTGTCTCTGCTGGAAGGTCGTTTAGACAACGTTATTTATCGTATGGGCTTTGGCGCTACCCGCGCAGAAGCACGTCAGATCGTCAGCCACAAAGCTGTCATGGTAAATGGCCGTGTTGTAAACATTGCTTCTTATCAGGTTTCCCCTAACGACGTAATCAGCATTCGTGAAAAAGCGAAAAAACAGTCTCGTATTAAGGCTGCTTTAGAGCTGGCTGAGCAGCGTGAAAAACCAACTTGGTTGGAAGTTGATGCTGCGAAAATGGAAGGTGTGTTCAAACGTATTCCTGAGCGTACTGACCTTTCTGCTGATATTAACGAGCACCTGATCGTCGAGCTTTACTCTAAGTAAGGCTTAGCACCAAAGAGAGGACACAATGCAGGGTTCTGTGACAGAGTTTC