Homologs in group_3734

Help

2 homologs were identified in 2 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
F4V73_RS15325 F4V73_RS15325 26.3 Morganella psychrotolerans nadS NadS family protein
PMI_RS02725 PMI_RS02725 35.5 Proteus mirabilis HI4320 nadS NadS family protein

Distribution of the homologs in the orthogroup group_3734

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3734

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q9KMA5 2.21e-29 104 48 1 104 1 higA-2 Antitoxin HigA-2 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q46864 3.29e-05 43 28 0 74 1 mqsA Antitoxin MqsA Escherichia coli (strain K12)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS15830
Feature type CDS
Gene -
Product type II toxin-antitoxin system MqsA family antitoxin
Location 3515773 - 3516084 (strand: 1)
Length 312 (nucleotides) / 103 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_3734
Orthogroup size 3
N. genomes 2

Actions

Genomic region

Domains

PF15731 Antitoxin component of bacterial toxin-antitoxin system, MqsA

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2944 Transcription (K) K DNA-binding transcriptional regulator YiaG, XRE-type HTH domain

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K07726 putative transcriptional regulator - -

Protein Sequence

MTKRDIFSELQEGMNAWSEFNEGKKTLKTHRINVKPLSMTPAEVKAVREKLNLSQAVFAQYLHTGVTTLQNWEQGIVKPNKQAVLLLKMVEKRPDTLIELAGL

Flanking regions ( +/- flanking 50bp)

ACGTGAACAGCTGAGAGCAATGTTAGAAATGATTAAAAAAAGGGGGGATCATGACTAAACGTGATATTTTTTCTGAGCTTCAAGAAGGAATGAATGCGTGGAGTGAATTTAATGAAGGGAAAAAAACACTAAAGACTCACCGTATTAATGTTAAGCCTCTTTCTATGACGCCAGCAGAAGTAAAAGCAGTACGTGAAAAATTGAATTTATCTCAAGCTGTTTTTGCTCAGTATTTACATACGGGGGTTACAACATTACAAAACTGGGAGCAAGGGATAGTAAAACCGAATAAACAAGCGGTTTTACTACTTAAAATGGTTGAAAAAAGACCGGATACGTTGATTGAGCTAGCAGGACTTTGATGTCGGTATGTTTAACGATAACTGAATAATTAACCCCTCTGGAGAGGGGC