Homologs in group_3723

Help

2 homologs were identified in 1 genome with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
PMI_RS02725 PMI_RS02725 44.7 Proteus mirabilis HI4320 nadS NadS family protein
PMI_RS15830 PMI_RS15830 26.3 Proteus mirabilis HI4320 - type II toxin-antitoxin system MqsA family antitoxin

Distribution of the homologs in the orthogroup group_3723

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3723

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0A9V5 3.27e-08 50 31 1 86 4 yiaG Uncharacterized HTH-type transcriptional regulator YiaG Escherichia coli (strain K12)
P0A9V6 3.27e-08 50 31 1 86 4 yiaG Uncharacterized HTH-type transcriptional regulator YiaG Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0A9V7 3.27e-08 50 31 1 86 4 yiaG Uncharacterized HTH-type transcriptional regulator YiaG Escherichia coli O157:H7
Q9KMA5 0.000188 40 25 2 102 1 higA-2 Antitoxin HigA-2 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS15325
Feature type CDS
Gene nadS
Product NadS family protein
Location 49919 - 50224 (strand: -1)
Length 306 (nucleotides) / 101 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000005
Length 213534 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3723
Orthogroup size 3
N. genomes 2

Actions

Genomic region

Domains

PF01381 Helix-turn-helix

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2944 Transcription (K) K DNA-binding transcriptional regulator YiaG, XRE-type HTH domain

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K07726 putative transcriptional regulator - -

Protein Sequence

MDKKLFNDLISSMEEMVAIEAGHIIPAPENIHKHPVPDVKAIRQHAGLKQSEFADAIGSSIDLVRSWEQQRRIPSGIALKMLCLIEKQPALLCTLKAMTIS

Flanking regions ( +/- flanking 50bp)

ATTAAGTTTATATAACTAACTTCCCACACTTCCGGCAGGAGAGATTCATTATGGATAAGAAACTTTTCAATGATTTGATCAGTAGCATGGAGGAAATGGTAGCTATTGAAGCAGGCCATATTATTCCTGCACCAGAGAATATACATAAACATCCGGTTCCGGATGTTAAAGCTATCCGGCAACATGCAGGATTAAAACAATCAGAGTTTGCTGACGCGATCGGTTCAAGTATTGATCTTGTCCGTAGCTGGGAGCAACAGCGCCGTATTCCGTCAGGGATTGCACTAAAGATGCTGTGTCTTATTGAGAAACAGCCGGCGCTCCTCTGTACGTTAAAAGCAATGACAATCAGCTGACAATAAGTAAAATCAGCAAAGAGATTACTTATGGTCATTTGCCCGCCCCC