Homologs in group_3734
2 homologs were identified in 1 genome with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.
| Locus tag | Identity | Source | Gene | Product | |
|---|---|---|---|---|---|
| PMI_RS02725 | PMI_RS02725 | 44.7 | Proteus mirabilis HI4320 | nadS | NadS family protein |
| PMI_RS15830 | PMI_RS15830 | 26.3 | Proteus mirabilis HI4320 | - | type II toxin-antitoxin system MqsA family antitoxin |
Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).
| Swissprot accession | Eval | Score | ID (%) | N gaps | Alignment length | Annot score | Gene | Description | Organism |
|---|---|---|---|---|---|---|---|---|---|
| P0A9V5 | 3.27e-08 | 50 | 31 | 1 | 86 | 4 | yiaG | Uncharacterized HTH-type transcriptional regulator YiaG | Escherichia coli (strain K12) |
| P0A9V6 | 3.27e-08 | 50 | 31 | 1 | 86 | 4 | yiaG | Uncharacterized HTH-type transcriptional regulator YiaG | Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) |
| P0A9V7 | 3.27e-08 | 50 | 31 | 1 | 86 | 4 | yiaG | Uncharacterized HTH-type transcriptional regulator YiaG | Escherichia coli O157:H7 |
| Q9KMA5 | 0.000188 | 40 | 25 | 2 | 102 | 1 | higA-2 | Antitoxin HigA-2 | Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) |
| Source | Morganella psychrotolerans |
|---|---|
| Locus tag | F4V73_RS15325 |
| Feature type | CDS |
| Gene | nadS |
| Product | NadS family protein |
| Location | 49919 - 50224 (strand: -1) |
| Length | 306 (nucleotides) / 101 (amino acids) |
| Accession | term accessions NZ_VXKB01000005 accessions NZ_VXKB01000000 Name: value, dtype: object |
|---|---|
| Length | 213534 nucleotides |
| Topology | linear |
| Plasmid | False |
| Orthogroup | group_3734 | |
|---|---|---|
| Orthogroup size | 3 | |
| N. genomes | 2 |
| PF01381 | Helix-turn-helix |
|---|
| ID | Function(s) descr. | Function(s) cat. | Description |
|---|---|---|---|
| COG2944 | Transcription (K) | K | DNA-binding transcriptional regulator YiaG, XRE-type HTH domain |
| KO | Description | Pathways | Modules |
|---|---|---|---|
| K07726 | putative transcriptional regulator | - | - |
MDKKLFNDLISSMEEMVAIEAGHIIPAPENIHKHPVPDVKAIRQHAGLKQSEFADAIGSSIDLVRSWEQQRRIPSGIALKMLCLIEKQPALLCTLKAMTIS
ATTAAGTTTATATAACTAACTTCCCACACTTCCGGCAGGAGAGATTCATTATGGATAAGAAACTTTTCAATGATTTGATCAGTAGCATGGAGGAAATGGTAGCTATTGAAGCAGGCCATATTATTCCTGCACCAGAGAATATACATAAACATCCGGTTCCGGATGTTAAAGCTATCCGGCAACATGCAGGATTAAAACAATCAGAGTTTGCTGACGCGATCGGTTCAAGTATTGATCTTGTCCGTAGCTGGGAGCAACAGCGCCGTATTCCGTCAGGGATTGCACTAAAGATGCTGTGTCTTATTGAGAAACAGCCGGCGCTCCTCTGTACGTTAAAAGCAATGACAATCAGCTGACAATAAGTAAAATCAGCAAAGAGATTACTTATGGTCATTTGCCCGCCCCC
